BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30888.Seq (447 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC890.08 |rpl31||60S ribosomal protein L31|Schizosaccharomyces... 53 2e-08 >SPAC890.08 |rpl31||60S ribosomal protein L31|Schizosaccharomyces pombe|chr 1|||Manual Length = 113 Score = 52.8 bits (121), Expect = 2e-08 Identities = 28/68 (41%), Positives = 42/68 (61%), Gaps = 1/68 (1%) Frame = +2 Query: 83 KSAINELLPVNIQLIYTNDFMVLXLKKRAPRAIKEIRKFAEKQMGNPDIR*N-SLKQILW 259 KSAIN+++ + + + KKRAPRAIKEI FA+K M ++R + SL + +W Sbjct: 6 KSAINQVVTRDYTIHMHKRLYGVSFKKRAPRAIKEIVAFAQKHMQTKEVRVDPSLNKEVW 65 Query: 260 SKGVXNVP 283 +G+ NVP Sbjct: 66 KRGIRNVP 73 Score = 43.6 bits (98), Expect = 1e-05 Identities = 16/27 (59%), Positives = 24/27 (88%) Frame = +1 Query: 97 RVVTREYTVNLHKRLHGVGFKKACPKS 177 +VVTR+YT+++HKRL+GV FKK P++ Sbjct: 11 QVVTRDYTIHMHKRLYGVSFKKRAPRA 37 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,516,069 Number of Sequences: 5004 Number of extensions: 24807 Number of successful extensions: 44 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 41 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 43 length of database: 2,362,478 effective HSP length: 67 effective length of database: 2,027,210 effective search space used: 164204010 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -