BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30888.Seq (447 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF441189-1|AAL73401.1| 134|Apis mellifera ribosomal protein 49 ... 22 2.7 AB022907-1|BAA86908.1| 615|Apis mellifera glucose oxidase protein. 21 6.1 AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor p... 21 8.1 >AF441189-1|AAL73401.1| 134|Apis mellifera ribosomal protein 49 protein. Length = 134 Score = 22.2 bits (45), Expect = 2.7 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = +2 Query: 29 RYTKLKITMAKPKG 70 RY+KLK KPKG Sbjct: 26 RYSKLKRNWRKPKG 39 >AB022907-1|BAA86908.1| 615|Apis mellifera glucose oxidase protein. Length = 615 Score = 21.0 bits (42), Expect = 6.1 Identities = 10/40 (25%), Positives = 22/40 (55%) Frame = +2 Query: 77 KGKSAINELLPVNIQLIYTNDFMVLXLKKRAPRAIKEIRK 196 KG+ +N P++ +I++ND + +AI+ ++K Sbjct: 459 KGRITLNSKDPLDPPVIWSNDLATEHDRSVMIQAIRVVQK 498 >AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor protein. Length = 587 Score = 20.6 bits (41), Expect = 8.1 Identities = 12/38 (31%), Positives = 18/38 (47%) Frame = -2 Query: 218 SPSVFQRTXXXXXXXXGHAFLXPTP*SRLCKLTVYSRV 105 +PS +T H+ L PTP S K++ +RV Sbjct: 361 TPSKCSQTSVHYSNGQTHSQLCPTPRSTHLKVSGINRV 398 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 101,425 Number of Sequences: 438 Number of extensions: 1699 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 11697255 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -