SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30883.Seq
         (548 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AM292363-1|CAL23175.2|  347|Tribolium castaneum gustatory recept...    21   5.4  
AM292344-1|CAL23156.1|  291|Tribolium castaneum gustatory recept...    21   9.4  
AM292339-1|CAL23151.2|  387|Tribolium castaneum gustatory recept...    21   9.4  
AM292338-1|CAL23150.2|  372|Tribolium castaneum gustatory recept...    21   9.4  
AJ973445-1|CAJ01492.1|  127|Tribolium castaneum hypothetical pro...    21   9.4  

>AM292363-1|CAL23175.2|  347|Tribolium castaneum gustatory receptor
           candidate 42 protein.
          Length = 347

 Score = 21.4 bits (43), Expect = 5.4
 Identities = 13/33 (39%), Positives = 17/33 (51%)
 Frame = +1

Query: 157 H*SGKRIYPECTKLLDCGIVVLDYTGCIWTSIL 255
           H  G+ + P  T LL     V  Y+G +WT IL
Sbjct: 110 HTFGRFLAPNLTYLL-----VALYSGYVWTDIL 137


>AM292344-1|CAL23156.1|  291|Tribolium castaneum gustatory receptor
           candidate 23 protein.
          Length = 291

 Score = 20.6 bits (41), Expect = 9.4
 Identities = 6/12 (50%), Positives = 11/12 (91%)
 Frame = +3

Query: 372 IMSVIKLWFYQL 407
           I+S+++LW +QL
Sbjct: 199 IISLVQLWIFQL 210


>AM292339-1|CAL23151.2|  387|Tribolium castaneum gustatory receptor
           candidate 18 protein.
          Length = 387

 Score = 20.6 bits (41), Expect = 9.4
 Identities = 7/13 (53%), Positives = 9/13 (69%)
 Frame = +3

Query: 90  LSLCWRIYHLMRK 128
           LS C+ +YHL  K
Sbjct: 284 LSYCFNLYHLASK 296


>AM292338-1|CAL23150.2|  372|Tribolium castaneum gustatory receptor
           candidate 17 protein.
          Length = 372

 Score = 20.6 bits (41), Expect = 9.4
 Identities = 7/13 (53%), Positives = 9/13 (69%)
 Frame = +3

Query: 90  LSLCWRIYHLMRK 128
           LS C+ +YHL  K
Sbjct: 284 LSYCFNLYHLASK 296


>AJ973445-1|CAJ01492.1|  127|Tribolium castaneum hypothetical
           protein protein.
          Length = 127

 Score = 20.6 bits (41), Expect = 9.4
 Identities = 9/28 (32%), Positives = 18/28 (64%)
 Frame = -2

Query: 274 LRNDYSAKLMSRYNQCNQVQQCRNPTIL 191
           L+N+ +  L +  ++C+Q QQ  + TI+
Sbjct: 61  LKNNLADALQTSCSKCSQRQQDGSRTII 88


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 130,710
Number of Sequences: 336
Number of extensions: 2585
Number of successful extensions: 5
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5
length of database: 122,585
effective HSP length: 53
effective length of database: 104,777
effective search space used: 13516233
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -