BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30880.Seq (417 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_25960| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.5 SB_51816| Best HMM Match : 7tm_1 (HMM E-Value=6.4e-24) 29 2.0 SB_50934| Best HMM Match : HSP90 (HMM E-Value=0) 28 3.6 SB_19567| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.6 SB_15366| Best HMM Match : rve (HMM E-Value=0.00011) 27 6.2 SB_51620| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.2 SB_25197| Best HMM Match : TatC (HMM E-Value=1.8) 27 8.2 SB_11299| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.2 >SB_25960| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 208 Score = 29.1 bits (62), Expect = 1.5 Identities = 13/40 (32%), Positives = 21/40 (52%) Frame = +2 Query: 251 RTTLGMDPKFLRNPRFCKKGNLKPAKQLAKAAERKLPEKP 370 +T PK ++P+ KK PAK+ A+ +K +KP Sbjct: 158 KTKKAKSPKKAKSPKKAKKPKKSPAKKAARKPAKKSAKKP 197 >SB_51816| Best HMM Match : 7tm_1 (HMM E-Value=6.4e-24) Length = 384 Score = 28.7 bits (61), Expect = 2.0 Identities = 15/48 (31%), Positives = 23/48 (47%) Frame = -2 Query: 323 LASGYPSCKTLDSLKILDPCQGWFVPGLPWLFDTISVSFAVLVMICMI 180 L G P L IL G+FV G +L+ T + V+++IC + Sbjct: 146 LLPGLPLLALLSDKVILVYFPGFFVCGQEFLYPTGQIELGVIILICTL 193 >SB_50934| Best HMM Match : HSP90 (HMM E-Value=0) Length = 855 Score = 27.9 bits (59), Expect = 3.6 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +2 Query: 302 KKGNLKPAKQLAKAAERKLPEKPRPRNE 385 KKG KPA + A+ + K KP P++E Sbjct: 767 KKGEDKPAMEKAEDVDTKTDSKPDPKSE 794 >SB_19567| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1383 Score = 27.9 bits (59), Expect = 3.6 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = +3 Query: 207 KAHRNGIKKPRKTRH 251 K HRNGIKKPR R+ Sbjct: 175 KWHRNGIKKPRTNRY 189 >SB_15366| Best HMM Match : rve (HMM E-Value=0.00011) Length = 1178 Score = 27.1 bits (57), Expect = 6.2 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = +1 Query: 196 TKTAKLTEMVSKSQGRPGTNHPW 264 +KT+ M S S RPG N+PW Sbjct: 931 SKTSPTLTMRSNSTTRPGKNNPW 953 >SB_51620| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 451 Score = 27.1 bits (57), Expect = 6.2 Identities = 10/30 (33%), Positives = 17/30 (56%) Frame = +3 Query: 165 MAKSKNHTNHNQNRKAHRNGIKKPRKTRHE 254 + S +HN + R GIK+PR+++ E Sbjct: 342 LTTSPTMISHNNQQNDSRRGIKRPRRSQEE 371 >SB_25197| Best HMM Match : TatC (HMM E-Value=1.8) Length = 622 Score = 26.6 bits (56), Expect = 8.2 Identities = 14/38 (36%), Positives = 20/38 (52%), Gaps = 1/38 (2%) Frame = +3 Query: 156 LIKMAKSKNHTNHNQNRKAH-RNGIKKPRKTRHEPPLA 266 LI KSK+H NHN+ + H + I K H+ +A Sbjct: 571 LIVYCKSKHHANHNKGCERHFEDDINKCGCRNHDHTIA 608 >SB_11299| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3762 Score = 26.6 bits (56), Expect = 8.2 Identities = 11/27 (40%), Positives = 18/27 (66%), Gaps = 1/27 (3%) Frame = +2 Query: 299 CKK-GNLKPAKQLAKAAERKLPEKPRP 376 CK G +P KQ+A+ +++ +PE P P Sbjct: 1482 CKACGAERPNKQVAQPSKKTIPESPNP 1508 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,504,325 Number of Sequences: 59808 Number of extensions: 177146 Number of successful extensions: 595 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 563 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 594 length of database: 16,821,457 effective HSP length: 75 effective length of database: 12,335,857 effective search space used: 777158991 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -