BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30875.Seq (449 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 23 1.0 AF317551-1|AAG39634.1| 312|Tribolium castaneum distal-less prot... 21 5.4 U77974-1|AAB36556.1| 276|Tribolium castaneum transcription fact... 20 9.4 DQ659251-1|ABG47449.1| 366|Tribolium castaneum chitinase 11 pro... 20 9.4 AJ876407-1|CAI45288.1| 590|Tribolium castaneum phosphatase prot... 20 9.4 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 23.4 bits (48), Expect = 1.0 Identities = 12/34 (35%), Positives = 18/34 (52%), Gaps = 2/34 (5%) Frame = +2 Query: 101 SQLWKSSSRSPW*TMTES--XGDRRPSSMITPTK 196 S W S++ SPW T T + RP++ T T+ Sbjct: 1040 STWWSSTTTSPWWTTTTTRRTTTTRPTTTSTTTR 1073 >AF317551-1|AAG39634.1| 312|Tribolium castaneum distal-less protein. Length = 312 Score = 21.0 bits (42), Expect = 5.4 Identities = 15/47 (31%), Positives = 22/47 (46%), Gaps = 4/47 (8%) Frame = -1 Query: 179 SMKASCPPTILSSFTMGSLRNSSKVGKLEKSRP----YASCEYSRVN 51 S A+CPP+ SL S GK +K R Y+S + ++N Sbjct: 91 SYAANCPPSPKDDEKCLSLERPSGGGKGKKMRKPRTIYSSLQLQQLN 137 >U77974-1|AAB36556.1| 276|Tribolium castaneum transcription factor homolog protein. Length = 276 Score = 20.2 bits (40), Expect = 9.4 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = +3 Query: 84 SRFLQFPNFGRVPQG 128 +R+ +PNFG P G Sbjct: 174 ARYHPYPNFGVPPAG 188 >DQ659251-1|ABG47449.1| 366|Tribolium castaneum chitinase 11 protein. Length = 366 Score = 20.2 bits (40), Expect = 9.4 Identities = 8/23 (34%), Positives = 12/23 (52%) Frame = -2 Query: 121 GTLPKLGNWRNLDRTQVVNIVEL 53 GTL L +W +D + N+ L Sbjct: 67 GTLKILDSWNEIDLHGLENVANL 89 >AJ876407-1|CAI45288.1| 590|Tribolium castaneum phosphatase protein. Length = 590 Score = 20.2 bits (40), Expect = 9.4 Identities = 7/23 (30%), Positives = 13/23 (56%) Frame = +1 Query: 181 DYPHQVSFVVNNTYFCGGSIISE 249 D HQ S ++NN C ++++ Sbjct: 316 DKAHQESIIMNNILPCVKELVAD 338 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 89,468 Number of Sequences: 336 Number of extensions: 1572 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 52 effective length of database: 105,113 effective search space used: 10195961 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -