BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30871.Seq (499 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659253-1|ABG47451.1| 439|Tribolium castaneum imaginal disc gr... 21 4.7 DQ659248-1|ABG47446.1| 496|Tribolium castaneum chitinase 8 prot... 21 8.1 >DQ659253-1|ABG47451.1| 439|Tribolium castaneum imaginal disc growth factor 2 protein. Length = 439 Score = 21.4 bits (43), Expect = 4.7 Identities = 7/16 (43%), Positives = 10/16 (62%) Frame = -3 Query: 119 LLALFCRIFLKHICYY 72 L A +C+ K +CYY Sbjct: 15 LFAAYCKAESKVVCYY 30 >DQ659248-1|ABG47446.1| 496|Tribolium castaneum chitinase 8 protein. Length = 496 Score = 20.6 bits (41), Expect = 8.1 Identities = 11/43 (25%), Positives = 20/43 (46%) Frame = -2 Query: 426 YLFSKDLGRPSLWPMLSAATHNTSQSSFGITRLINSGLKSTSL 298 Y S +L +W + + + S + + I IN+ LKS + Sbjct: 349 YAKSLNLAGVMIWSIETDDFNGLSGTKYQILNAINAALKSDEI 391 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 115,756 Number of Sequences: 336 Number of extensions: 2351 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 11735024 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -