BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30868.Seq (409 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AJ780964-1|CAG62942.2| 332|Apis mellifera putative corticotropi... 25 0.25 Z26319-1|CAA81228.1| 464|Apis mellifera royal jelly protein RJP... 24 0.76 EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. 21 4.1 AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. 21 4.1 AF004842-1|AAD01205.1| 598|Apis mellifera major royal jelly pro... 21 7.1 AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 21 7.1 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 20 9.4 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 20 9.4 >AJ780964-1|CAG62942.2| 332|Apis mellifera putative corticotropin releasing hormone-binding protein protein. Length = 332 Score = 25.4 bits (53), Expect = 0.25 Identities = 15/52 (28%), Positives = 23/52 (44%) Frame = +1 Query: 10 SGSCFSKHVKNSLNINKII*QNKYFKIK*TIRCVXIYSNDFIFLYRIENSSK 165 SG FSK N ++ N Y + K C+ + S FLY +N ++ Sbjct: 40 SGDRFSKDFYRQDTKNNLL--NAYVRFKLVTDCIFVTSEPGYFLYTSKNDNE 89 >Z26319-1|CAA81228.1| 464|Apis mellifera royal jelly protein RJP57-2 protein. Length = 464 Score = 23.8 bits (49), Expect = 0.76 Identities = 8/27 (29%), Positives = 12/27 (44%) Frame = +3 Query: 171 KSKNHTNHNQNRKAHRNGIKKPRKTRH 251 + NH NHN N+ H + +H Sbjct: 420 QDNNHYNHNHNQARHSSKSDNQNNNQH 446 >EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. Length = 683 Score = 21.4 bits (43), Expect = 4.1 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = -3 Query: 320 ASGYPSCKPFDPLKIL 273 A G+P KP DPL ++ Sbjct: 645 AMGFPLDKPVDPLLLV 660 >AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. Length = 683 Score = 21.4 bits (43), Expect = 4.1 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = -3 Query: 320 ASGYPSCKPFDPLKIL 273 A G+P KP DPL ++ Sbjct: 645 AMGFPLDKPVDPLLLV 660 >AF004842-1|AAD01205.1| 598|Apis mellifera major royal jelly protein MRJP5 protein. Length = 598 Score = 20.6 bits (41), Expect = 7.1 Identities = 8/22 (36%), Positives = 10/22 (45%) Frame = +3 Query: 156 LIKMAKSKNHTNHNQNRKAHRN 221 LI + N N N N+ H N Sbjct: 577 LIMNTRCANSDNQNNNQNKHNN 598 >AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase protein. Length = 1143 Score = 20.6 bits (41), Expect = 7.1 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = -3 Query: 311 YPSCKPFDPLKIL 273 +PS +PF PL +L Sbjct: 877 FPSVRPFAPLLLL 889 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 20.2 bits (40), Expect = 9.4 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = +3 Query: 213 HRNGIKKPRKTRHEPPLA 266 H NGI + K +EP LA Sbjct: 1139 HSNGIIQGYKLHYEPILA 1156 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 20.2 bits (40), Expect = 9.4 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = +3 Query: 213 HRNGIKKPRKTRHEPPLA 266 H NGI + K +EP LA Sbjct: 1135 HSNGIIQGYKLHYEPILA 1152 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 92,710 Number of Sequences: 438 Number of extensions: 1704 Number of successful extensions: 8 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 52 effective length of database: 123,567 effective search space used: 10256061 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -