BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30864.Seq (698 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954257-13|CAJ14164.1| 420|Anopheles gambiae predicted protein... 31 0.046 AY428512-1|AAR89530.1| 420|Anopheles gambiae EKN1 protein. 31 0.046 DQ230893-2|ABD94312.1| 525|Anopheles gambiae iduronate 2-sulfat... 23 9.2 >CR954257-13|CAJ14164.1| 420|Anopheles gambiae predicted protein protein. Length = 420 Score = 30.7 bits (66), Expect = 0.046 Identities = 15/53 (28%), Positives = 25/53 (47%) Frame = +2 Query: 407 FSEQKYDEAINLYTAAIQLNPQSALLFAKRGQVY*N*TNQMACIKDCTHGLRV 565 F ++ + AI+ Y+A I+L LF R + N C +DC+ L + Sbjct: 294 FQQRNFLAAISAYSAGIRLTKDYYALFLNRSAAHLALENYQRCAEDCSTALEL 346 >AY428512-1|AAR89530.1| 420|Anopheles gambiae EKN1 protein. Length = 420 Score = 30.7 bits (66), Expect = 0.046 Identities = 15/53 (28%), Positives = 25/53 (47%) Frame = +2 Query: 407 FSEQKYDEAINLYTAAIQLNPQSALLFAKRGQVY*N*TNQMACIKDCTHGLRV 565 F ++ + AI+ Y+A I+L LF R + N C +DC+ L + Sbjct: 294 FQQRNFLAAISAYSAGIRLTKDYYALFLNRSAAHLALENYQRCAEDCSTALEL 346 >DQ230893-2|ABD94312.1| 525|Anopheles gambiae iduronate 2-sulfatase precursor protein. Length = 525 Score = 23.0 bits (47), Expect = 9.2 Identities = 13/30 (43%), Positives = 20/30 (66%), Gaps = 2/30 (6%) Frame = -1 Query: 680 IIVNLLRIPQRSVGRFFK--FTQEPICSPS 597 I VN+ R+ Q+ G FF+ F Q+ +C+PS Sbjct: 55 ITVNIDRLVQQ--GFFFQNAFAQQALCAPS 82 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 687,845 Number of Sequences: 2352 Number of extensions: 14173 Number of successful extensions: 11 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 71086350 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -