BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30863.Seq (427 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_50019| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 2e-07 SB_42441| Best HMM Match : DUF1484 (HMM E-Value=0.48) 41 4e-04 >SB_50019| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 849 Score = 52.0 bits (119), Expect = 2e-07 Identities = 23/48 (47%), Positives = 32/48 (66%) Frame = +1 Query: 265 NVPFXXXXXXXXXXNDDEDSAHKLFTLVTYVPVASIKGLQTENVDASQ 408 NVP+ N+DEDS HKL+TLVT V V++ KGLQT+ V++ + Sbjct: 802 NVPYRVRVRLARKRNEDEDSPHKLYTLVTSVAVSTFKGLQTQKVESEE 849 Score = 39.5 bits (88), Expect = 0.001 Identities = 16/31 (51%), Positives = 22/31 (70%) Frame = +2 Query: 62 KKRQISHKRIVTREYTVNLHKRLHGVGFKKR 154 KK + + +VTREYT+NLHKR+HG+ R Sbjct: 776 KKGRSAINEVVTREYTINLHKRIHGMNVPYR 806 >SB_42441| Best HMM Match : DUF1484 (HMM E-Value=0.48) Length = 776 Score = 41.1 bits (92), Expect = 4e-04 Identities = 20/42 (47%), Positives = 25/42 (59%) Frame = +1 Query: 265 NVPFXXXXXXXXXXNDDEDSAHKLFTLVTYVPVASIKGLQTE 390 NVP+ N+DEDS HKL+TLVT V V++ K L E Sbjct: 2 NVPYRVRVRLARKRNEDEDSPHKLYTLVTSVAVSTFKVLADE 43 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,749,628 Number of Sequences: 59808 Number of extensions: 248987 Number of successful extensions: 449 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 438 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 449 length of database: 16,821,457 effective HSP length: 75 effective length of database: 12,335,857 effective search space used: 814166562 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -