BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30862.Seq (598 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U43499-1|AAA93302.1| 278|Anopheles gambiae a-emp protein. 23 5.7 AY280611-1|AAQ21364.1| 1102|Anopheles gambiae chloride/bicarbona... 23 7.5 >U43499-1|AAA93302.1| 278|Anopheles gambiae a-emp protein. Length = 278 Score = 23.4 bits (48), Expect = 5.7 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -2 Query: 198 INTSSGVNLWGYKAPLL 148 + S G LWGY+ PLL Sbjct: 90 VEVSVGQLLWGYEDPLL 106 >AY280611-1|AAQ21364.1| 1102|Anopheles gambiae chloride/bicarbonate anion exchanger protein. Length = 1102 Score = 23.0 bits (47), Expect = 7.5 Identities = 8/31 (25%), Positives = 17/31 (54%) Frame = +3 Query: 357 WITQKITEILNMEDDVVIEYVTNQLEEKFPC 449 WI+ + ++ ++ ++ Y+T EE F C Sbjct: 615 WISIILVVLVAVDASALVCYITRFTEENFAC 645 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 604,423 Number of Sequences: 2352 Number of extensions: 11553 Number of successful extensions: 15 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 57609459 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -