BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30860.Seq (449 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_03_0289 - 11688733-11691342 27 7.0 01_01_0827 + 6443319-6446085,6446317-6446407,6446502-6448017,644... 27 9.2 >05_03_0289 - 11688733-11691342 Length = 869 Score = 27.1 bits (57), Expect = 7.0 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = -3 Query: 165 YGGGPGIDMTAXPSLKFEEPKLDPIDEQAAP 73 YG G+ A +++ + PK DP E AAP Sbjct: 251 YGAAVGVTYQANDTVQIKYPKNDPDAEYAAP 281 >01_01_0827 + 6443319-6446085,6446317-6446407,6446502-6448017, 6448164-6448243,6449045-6449129,6449221-6449312, 6449388-6449456,6449544-6449580,6449662-6449744, 6450427-6450873,6450978-6451014,6451101-6451158, 6451243-6451382,6451610-6451675,6451794-6451908, 6453261-6453299,6453482-6453543 Length = 1927 Score = 26.6 bits (56), Expect = 9.2 Identities = 14/49 (28%), Positives = 23/49 (46%) Frame = -1 Query: 365 VGLRAATTSMMVSRNLAAAQKATDPIQQLFLDKIXEYNRRARXXKXQMP 219 VG + ATTS + S NL QKA + + E ++ + ++P Sbjct: 1334 VGFQTATTSNLYSSNLCQNQKANSEVLHGVSSNLIENSKDDKKTSPKVP 1382 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,974,653 Number of Sequences: 37544 Number of extensions: 156645 Number of successful extensions: 235 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 235 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 235 length of database: 14,793,348 effective HSP length: 76 effective length of database: 11,940,004 effective search space used: 871620292 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -