BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30858.Seq (548 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF531707-1|ABP57431.1| 138|Apis mellifera structural cuticle pr... 25 0.38 AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr... 23 1.5 DQ869053-1|ABJ09600.1| 459|Apis mellifera capa-like receptor pr... 21 6.2 AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 21 6.2 AB022908-1|BAA86909.1| 493|Apis mellifera amylase protein. 21 8.2 >EF531707-1|ABP57431.1| 138|Apis mellifera structural cuticle protein protein. Length = 138 Score = 25.4 bits (53), Expect = 0.38 Identities = 11/29 (37%), Positives = 14/29 (48%) Frame = +1 Query: 334 DGEAVEFAVVAGEKGFEAAGVTGPGGEPV 420 DG+ V VA E GF+ G P P+ Sbjct: 81 DGQQVSITYVADENGFQVQGSHIPTAPPI 109 >AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein protein. Length = 1308 Score = 23.4 bits (48), Expect = 1.5 Identities = 11/43 (25%), Positives = 20/43 (46%) Frame = +1 Query: 220 QRQEWIWFHQQDDTKEDVFVHQTAIARNNPRKAVRSVGDGEAV 348 +R+EW++ H+ E HQ +K V S+ +A+ Sbjct: 726 RRKEWLYLHRARSESEFEMYHQQLQGVAKNKKNVGSMSRNKAL 768 >DQ869053-1|ABJ09600.1| 459|Apis mellifera capa-like receptor protein. Length = 459 Score = 21.4 bits (43), Expect = 6.2 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = -3 Query: 495 SSATLTREILAVVATALVC 439 S T+TR + AVV T +C Sbjct: 254 SRKTITRMLSAVVITFFIC 272 >AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. Length = 735 Score = 21.4 bits (43), Expect = 6.2 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = -3 Query: 528 IPPLRGAPXPP 496 +PP GAP PP Sbjct: 409 LPPSAGAPMPP 419 >AB022908-1|BAA86909.1| 493|Apis mellifera amylase protein. Length = 493 Score = 21.0 bits (42), Expect = 8.2 Identities = 6/11 (54%), Positives = 9/11 (81%) Frame = -2 Query: 82 VIGERRWWQRW 50 VI +R WW+R+ Sbjct: 70 VIDKRPWWERY 80 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 126,490 Number of Sequences: 438 Number of extensions: 2183 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 15704448 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -