BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30855.Seq (628 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g60670.1 68418.m07614 60S ribosomal protein L12 (RPL12C) 60S ... 132 2e-31 At3g53430.1 68416.m05896 60S ribosomal protein L12 (RPL12B) 60S ... 128 2e-30 At2g37190.1 68415.m04562 60S ribosomal protein L12 (RPL12A) 128 2e-30 At3g47110.1 68416.m05115 leucine-rich repeat transmembrane prote... 28 4.4 At1g61080.1 68414.m06877 proline-rich family protein 28 4.4 At1g15500.1 68414.m01865 chloroplast ADP, ATP carrier protein, p... 28 4.4 At1g51450.1 68414.m05791 SPla/RYanodine receptor (SPRY) domain-c... 28 5.8 >At5g60670.1 68418.m07614 60S ribosomal protein L12 (RPL12C) 60S RIBOSOMAL PROTEIN L12 (like), Arabidopsis thaliana, PIR:T45883 Length = 166 Score = 132 bits (318), Expect = 2e-31 Identities = 67/99 (67%), Positives = 78/99 (78%) Frame = +3 Query: 252 KDWKGLKITVQLTVQNRQAQIAVVPSAAALIIRALKEPPRDRKKQKNIKHNGNISLEDVI 431 K+WKGL++TV+LTVQNRQA++ VVPSAAAL+I+ALKEP RDRKK KNIKHNGNIS +DVI Sbjct: 52 KEWKGLRVTVKLTVQNRQAKVTVVPSAAALVIKALKEPERDRKKVKNIKHNGNISFDDVI 111 Query: 432 GIAKIMRNXSMARYLSGXSKRGFLGTHSSVGMYCGGAGP 548 IAKIMR S+A+ LSG K LGT SVG G P Sbjct: 112 EIAKIMRPRSIAKELSGTVKE-ILGTCVSVGCTVDGKDP 149 Score = 79.8 bits (188), Expect = 1e-15 Identities = 36/50 (72%), Positives = 42/50 (84%) Frame = +1 Query: 103 MPPKFDPNEIKIVNLRCVGGEVGATSSLAPKIGPLGLSPKKVGDDIAKAT 252 MPPK DP++I V +R GGEVGA SSLAPKIGPLGL+PKK+G+DIAK T Sbjct: 1 MPPKLDPSQIVDVYVRVTGGEVGAASSLAPKIGPLGLAPKKIGEDIAKET 50 >At3g53430.1 68416.m05896 60S ribosomal protein L12 (RPL12B) 60S RIBOSOMAL PROTEIN L12, Prunus armeniaca, SWISSPROT:RL12_PRUAR Length = 166 Score = 128 bits (310), Expect = 2e-30 Identities = 65/99 (65%), Positives = 78/99 (78%) Frame = +3 Query: 252 KDWKGLKITVQLTVQNRQAQIAVVPSAAALIIRALKEPPRDRKKQKNIKHNGNISLEDVI 431 K+WKGL++TV+LTVQNRQA++ VVPSAAAL+I+ALKEP RDRKK KNIKHNGNIS +DV Sbjct: 52 KEWKGLRVTVKLTVQNRQAKVTVVPSAAALVIKALKEPERDRKKVKNIKHNGNISFDDVT 111 Query: 432 GIAKIMRNXSMARYLSGXSKRGFLGTHSSVGMYCGGAGP 548 IA+IMR S+A+ LSG + R LGT SVG G P Sbjct: 112 EIARIMRPRSIAKELSG-TVREILGTCVSVGCTVDGKDP 149 Score = 79.8 bits (188), Expect = 1e-15 Identities = 36/50 (72%), Positives = 42/50 (84%) Frame = +1 Query: 103 MPPKFDPNEIKIVNLRCVGGEVGATSSLAPKIGPLGLSPKKVGDDIAKAT 252 MPPK DP++I V +R GGEVGA SSLAPKIGPLGL+PKK+G+DIAK T Sbjct: 1 MPPKLDPSQIVDVYVRVTGGEVGAASSLAPKIGPLGLAPKKIGEDIAKET 50 >At2g37190.1 68415.m04562 60S ribosomal protein L12 (RPL12A) Length = 166 Score = 128 bits (310), Expect = 2e-30 Identities = 65/99 (65%), Positives = 78/99 (78%) Frame = +3 Query: 252 KDWKGLKITVQLTVQNRQAQIAVVPSAAALIIRALKEPPRDRKKQKNIKHNGNISLEDVI 431 K+WKGL++TV+LTVQNRQA++ VVPSAAAL+I+ALKEP RDRKK KNIKHNGNIS +DV Sbjct: 52 KEWKGLRVTVKLTVQNRQAKVTVVPSAAALVIKALKEPERDRKKVKNIKHNGNISFDDVT 111 Query: 432 GIAKIMRNXSMARYLSGXSKRGFLGTHSSVGMYCGGAGP 548 IA+IMR S+A+ LSG + R LGT SVG G P Sbjct: 112 EIARIMRPRSIAKELSG-TVREILGTCVSVGCTVDGKDP 149 Score = 79.8 bits (188), Expect = 1e-15 Identities = 36/50 (72%), Positives = 42/50 (84%) Frame = +1 Query: 103 MPPKFDPNEIKIVNLRCVGGEVGATSSLAPKIGPLGLSPKKVGDDIAKAT 252 MPPK DP++I V +R GGEVGA SSLAPKIGPLGL+PKK+G+DIAK T Sbjct: 1 MPPKLDPSQIVDVYVRVTGGEVGAASSLAPKIGPLGLAPKKIGEDIAKET 50 >At3g47110.1 68416.m05115 leucine-rich repeat transmembrane protein kinase, putative protein kinase Xa21 receptor type precursor, Oryza sativa, PIR:A57676 Length = 1025 Score = 28.3 bits (60), Expect = 4.4 Identities = 11/44 (25%), Positives = 25/44 (56%) Frame = -1 Query: 481 PERYRAIXLFLMIFAMPITSSREMLPLCLIFFCFLRSRGGSLRA 350 P R+ ++ + I + ++ +L LC+++ C+ + R S+RA Sbjct: 645 PRRHSSVRKIITICVSAVMAALLLLCLCVVYLCWYKLRVKSVRA 688 >At1g61080.1 68414.m06877 proline-rich family protein Length = 907 Score = 28.3 bits (60), Expect = 4.4 Identities = 15/40 (37%), Positives = 18/40 (45%) Frame = -1 Query: 613 KHFXHPMVKTPAXDVIK*ESCGGPAPPQYIPTELCVPKNP 494 KHF P PA +K S P PP +PT + P P Sbjct: 488 KHFAPPPPTPPAFKPLK-GSAPPPPPPPPLPTTIAAPPPP 526 >At1g15500.1 68414.m01865 chloroplast ADP, ATP carrier protein, putative / ADP, ATP translocase, putative / adenine nucleotide translocase, putative strong similarity to SP|Q39002 Chloroplast ADP,ATP carrier protein 1, chloroplast precursor (ADP/ATP translocase 1) (Adenine nucleotide translocase 1) {Arabidopsis thaliana}; contains Pfam profile PF03219: TLC ATP/ADP transporter Length = 618 Score = 28.3 bits (60), Expect = 4.4 Identities = 10/23 (43%), Positives = 18/23 (78%) Frame = -1 Query: 445 IFAMPITSSREMLPLCLIFFCFL 377 IF + +T+ ++++PL L+FFC L Sbjct: 102 IFGVEVTTLKKIVPLGLMFFCIL 124 >At1g51450.1 68414.m05791 SPla/RYanodine receptor (SPRY) domain-containing protein low similarity to DEAD box protein DDX1 [Gallus gallus] GI:16323037, ryanodine receptor [Caenorhabditis elegans] GI:1871447; contains Pfam profile PF00622: SPRY domain Length = 509 Score = 27.9 bits (59), Expect = 5.8 Identities = 16/55 (29%), Positives = 24/55 (43%) Frame = +3 Query: 249 HKDWKGLKITVQLTVQNRQAQIAVVPSAAALIIRALKEPPRDRKKQKNIKHNGNI 413 HK K L + V+ + V+PS A ++ A KK K+ K N N+ Sbjct: 172 HKKLKQLDCLTSVAVKEEEEPEQVLPSEAMVVEEAATLVASAAKKSKSKKKNNNV 226 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,541,236 Number of Sequences: 28952 Number of extensions: 306166 Number of successful extensions: 748 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 709 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 747 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1275599520 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -