BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30854.Seq (598 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_48657| Best HMM Match : GST_C (HMM E-Value=5.8e-07) 78 5e-15 SB_47549| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.13 SB_7437| Best HMM Match : PAS (HMM E-Value=7.2e-14) 31 0.93 SB_13066| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_51105| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_51364| Best HMM Match : DUF1431 (HMM E-Value=5.9) 29 3.8 SB_45214| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.7 SB_40685| Best HMM Match : NPIP (HMM E-Value=1.8) 27 8.7 SB_28690| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.7 >SB_48657| Best HMM Match : GST_C (HMM E-Value=5.8e-07) Length = 203 Score = 78.2 bits (184), Expect = 5e-15 Identities = 37/71 (52%), Positives = 47/71 (66%) Frame = +1 Query: 1 YTYPENFRAYKALIAAQYSGTDVKVAPNFVFGETNKSEDFLKKFPAGKVPAFESADGKVL 180 YTYP++FRA K LIAA+YSGT ++V P F FG+ N + +FLKKFP GKVPAFE+ Sbjct: 7 YTYPDSFRAQKILIAAEYSGTKIEV-PAFTFGKDNHTAEFLKKFPLGKVPAFETKTANAC 65 Query: 181 LTESNAIAYYV 213 + YV Sbjct: 66 TRAMPLLTTYV 76 Score = 64.9 bits (151), Expect = 5e-11 Identities = 30/74 (40%), Positives = 48/74 (64%) Frame = +3 Query: 267 WASWSDSELLPASCAWVFPYLGIMQFNKQNVERAKSDLLAALKVLDGHLLTRTFLVXERI 446 + +++D ELLPA+ WVFP G+MQ++KQ+ ++A D+ + +L+ LL +TFLV ER+ Sbjct: 75 YVNFADQELLPAAATWVFPTYGMMQYHKQSTDKAMEDVKKYMTMLNDVLLMKTFLVGERV 134 Query: 447 TCRWSLSSVHCCML 488 T CC+L Sbjct: 135 TL---ADIAVCCVL 145 >SB_47549| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 302 Score = 33.5 bits (73), Expect = 0.13 Identities = 16/48 (33%), Positives = 27/48 (56%) Frame = +1 Query: 334 SCNSTNRMLNVQSLTYWPP*KYWTDIFSHAPSLLXRESLVDGHCLQYT 477 + N T+ N L+ +P KY+ D F++A L R S+++ HC+ T Sbjct: 209 TANITDLPRNSSKLSCFPEQKYYLDEFAYARRYLSRLSIIEIHCIWQT 256 >SB_7437| Best HMM Match : PAS (HMM E-Value=7.2e-14) Length = 505 Score = 30.7 bits (66), Expect = 0.93 Identities = 18/71 (25%), Positives = 30/71 (42%) Frame = +1 Query: 16 NFRAYKALIAAQYSGTDVKVAPNFVFGETNKSEDFLKKFPAGKVPAFESADGKVLLTESN 195 N +K + Q + K+ P V GE N + +KK +P GK + + + Sbjct: 105 NIGKFKMVWIDQIDESTKKLKPKMVAGEDNGFVNAIKKVSLEDIPEGNGPSGKAIREKRS 164 Query: 196 AIAYYVANESL 228 I + N+SL Sbjct: 165 IIVNDIENDSL 175 >SB_13066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 865 Score = 29.9 bits (64), Expect = 1.6 Identities = 10/25 (40%), Positives = 17/25 (68%) Frame = +2 Query: 200 SLTTLPMKVSAEEIWLPKPCLAVGI 274 +LTTLP ++ E++W+ C +GI Sbjct: 645 ALTTLPTPITVEQLWIKDVCNEIGI 669 >SB_51105| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1280 Score = 29.9 bits (64), Expect = 1.6 Identities = 17/85 (20%), Positives = 40/85 (47%) Frame = -1 Query: 364 RSTFCLLNCMIPR*GKTQAQEAGSSSLSDHDAHCQTRLG*PDLLRGDFHWQRSKRWHCFQ 185 R+ +C+L+ M+P + + A + + H A Q L + + +W+++ + Sbjct: 33 RAAYCILSPMVPGGERKNGRSASTEMAATHRAPKQWSLSKTETITSFENWKQN-LMYTLS 91 Query: 184 LEAPFHRHFRMQALFRQETSSRSLR 110 L+ F + A ++++T + LR Sbjct: 92 LDTNFSTYLADGATWKRKTKTEPLR 116 >SB_51364| Best HMM Match : DUF1431 (HMM E-Value=5.9) Length = 364 Score = 28.7 bits (61), Expect = 3.8 Identities = 14/40 (35%), Positives = 22/40 (55%) Frame = -1 Query: 145 LFRQETSSRSLRTCWSRQIRNSVLLSHQSRNIVRRSTLYK 26 +FR + + + S ++ N V +SHQSR IV T+ K Sbjct: 102 VFRSKQQAPNKAVGRSDEVTNEVAVSHQSRRIVESETVRK 141 >SB_45214| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 196 Score = 27.5 bits (58), Expect = 8.7 Identities = 16/57 (28%), Positives = 25/57 (43%) Frame = +2 Query: 197 PSLTTLPMKVSAEEIWLPKPCLAVGIMV*QRTTACFLRLGLPLPWYHAIQQTEC*TC 367 PS+TT +++E +P+P + G + T C L L W A+ C C Sbjct: 109 PSMTTTYGGITSEARGIPEPIVTTGSAMNDSVTGCSL---LHQMWKKAVSDNFCALC 162 >SB_40685| Best HMM Match : NPIP (HMM E-Value=1.8) Length = 672 Score = 27.5 bits (58), Expect = 8.7 Identities = 15/48 (31%), Positives = 22/48 (45%) Frame = +3 Query: 429 LVXERITCRWSLSSVHCCMLFSTWLHPASVSSLINVSALGPDRRXPAG 572 L ER R ++ C LF++W + + +SAL P PAG Sbjct: 15 LFFERPIRRPRFVALRQCSLFNSWYNLEQEHQITTISALPPIATLPAG 62 >SB_28690| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2179 Score = 27.5 bits (58), Expect = 8.7 Identities = 15/38 (39%), Positives = 17/38 (44%) Frame = -1 Query: 571 PAGXRRSGPNAETFISDETDAGCSHVLKSMQQCTEDND 458 PA + S P E DE DAG S + EDND Sbjct: 134 PADLQPSSPGVELEYMDELDAGVGKEGTSEEDDKEDND 171 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,836,214 Number of Sequences: 59808 Number of extensions: 420906 Number of successful extensions: 1211 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 1115 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1209 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1439498375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -