BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30846.Seq (698 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. 23 3.7 AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. 23 3.7 AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. 23 3.7 AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. 23 3.7 AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. 23 3.7 AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. 23 3.7 AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. 23 3.7 AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex det... 23 3.7 AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisp... 22 4.9 DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chlor... 22 6.4 >AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.6 bits (46), Expect = 3.7 Identities = 8/34 (23%), Positives = 22/34 (64%) Frame = +3 Query: 246 QEEREIFKRAEQYVKEYRIKERDEIRLARQARNR 347 + ERE + ++ + EY ++ E +L++++++R Sbjct: 47 EREREHERLKKKMILEYELRRAREKKLSKRSKSR 80 >AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.6 bits (46), Expect = 3.7 Identities = 8/34 (23%), Positives = 22/34 (64%) Frame = +3 Query: 246 QEEREIFKRAEQYVKEYRIKERDEIRLARQARNR 347 + ERE + ++ + EY ++ E +L++++++R Sbjct: 47 EREREHERLKKKMILEYELRRAREKKLSKRSKSR 80 >AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.6 bits (46), Expect = 3.7 Identities = 8/34 (23%), Positives = 22/34 (64%) Frame = +3 Query: 246 QEEREIFKRAEQYVKEYRIKERDEIRLARQARNR 347 + ERE + ++ + EY ++ E +L++++++R Sbjct: 47 EREREHERLKKKMILEYELRRAREKKLSKRSKSR 80 >AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.6 bits (46), Expect = 3.7 Identities = 8/34 (23%), Positives = 22/34 (64%) Frame = +3 Query: 246 QEEREIFKRAEQYVKEYRIKERDEIRLARQARNR 347 + ERE + ++ + EY ++ E +L++++++R Sbjct: 47 EREREHERLKKKMILEYELRRAREKKLSKRSKSR 80 >AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.6 bits (46), Expect = 3.7 Identities = 8/34 (23%), Positives = 22/34 (64%) Frame = +3 Query: 246 QEEREIFKRAEQYVKEYRIKERDEIRLARQARNR 347 + ERE + ++ + EY ++ E +L++++++R Sbjct: 47 EREREHERLKKKMILEYELRRAREKKLSKRSKSR 80 >AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.6 bits (46), Expect = 3.7 Identities = 8/34 (23%), Positives = 22/34 (64%) Frame = +3 Query: 246 QEEREIFKRAEQYVKEYRIKERDEIRLARQARNR 347 + ERE + ++ + EY ++ E +L++++++R Sbjct: 47 EREREHERLKKKMILEYELRRAREKKLSKRSKSR 80 >AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. Length = 400 Score = 22.6 bits (46), Expect = 3.7 Identities = 8/34 (23%), Positives = 22/34 (64%) Frame = +3 Query: 246 QEEREIFKRAEQYVKEYRIKERDEIRLARQARNR 347 + ERE + ++ + EY ++ E +L++++++R Sbjct: 47 EREREHERLKKKMILEYELRRAREKKLSKRSKSR 80 >AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex determiner protein. Length = 401 Score = 22.6 bits (46), Expect = 3.7 Identities = 8/34 (23%), Positives = 22/34 (64%) Frame = +3 Query: 246 QEEREIFKRAEQYVKEYRIKERDEIRLARQARNR 347 + ERE + ++ + EY ++ E +L++++++R Sbjct: 47 EREREHERLKKKMILEYELRRAREKKLSKRSKSR 80 >AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform A protein. Length = 782 Score = 22.2 bits (45), Expect = 4.9 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = +3 Query: 393 RIRGINQVSPKSVKFCNCLDC 455 + GI+ +P C+CLDC Sbjct: 312 KYEGISS-TPSQASSCSCLDC 331 >DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chloride channel protein. Length = 428 Score = 21.8 bits (44), Expect = 6.4 Identities = 10/35 (28%), Positives = 16/35 (45%) Frame = +3 Query: 219 YAXEAFFCHQEEREIFKRAEQYVKEYRIKERDEIR 323 YA + FF + + E EYR+ E D ++ Sbjct: 82 YAADIFFAQTWKDNRLRLPENMTSEYRLLEVDWLK 116 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 182,071 Number of Sequences: 438 Number of extensions: 3815 Number of successful extensions: 12 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21439440 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -