BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30840.Seq (648 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC1198.04c |zas1||zinc finger protein Zas1|Schizosaccharomyces... 25 9.4 SPAC13F5.06c |sec10||exocyst complex subunit Sec10|Schizosacchar... 25 9.4 >SPBC1198.04c |zas1||zinc finger protein Zas1|Schizosaccharomyces pombe|chr 2|||Manual Length = 897 Score = 25.0 bits (52), Expect = 9.4 Identities = 13/43 (30%), Positives = 23/43 (53%), Gaps = 1/43 (2%) Frame = -1 Query: 285 LMHKHIFLGVILLMKPYP-LLTLNHFTVPDTFSAMTCFCLTVL 160 +++ FLG +L Y L+ HF + + F ++ FC T+L Sbjct: 90 MLNASCFLGFCVLAHDYVNLINARHFMI-EHFLSLFAFCRTIL 131 >SPAC13F5.06c |sec10||exocyst complex subunit Sec10|Schizosaccharomyces pombe|chr 1|||Manual Length = 811 Score = 25.0 bits (52), Expect = 9.4 Identities = 14/57 (24%), Positives = 26/57 (45%) Frame = -1 Query: 588 FLTPQSPCAPPLGWAGVHDVLILLCVDSFTASSATLTREILAVVATALVCSIR*AFY 418 +L C +G+ + + I++ TASS T IL+ + + C++ FY Sbjct: 572 YLVDIRECKKIMGYFSAYLMSIVIPFTGVTASSRRETVNILSSSISVIECAVNDVFY 628 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,217,815 Number of Sequences: 5004 Number of extensions: 35053 Number of successful extensions: 77 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 77 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 77 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 291768710 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -