BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30838.Seq (598 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC14F5.07 |||ER-localized ubiquitin ligase |Schizosaccharomyce... 25 8.4 SPAC19A8.12 |dcp2||mRNA decapping complex subunit Dcp2|Schizosac... 25 8.4 SPAC3G9.13c |msw1||mitochondrial tryptophan-tRNA ligase Msw1 |Sc... 25 8.4 >SPBC14F5.07 |||ER-localized ubiquitin ligase |Schizosaccharomyces pombe|chr 2|||Manual Length = 1242 Score = 25.0 bits (52), Expect = 8.4 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = +3 Query: 363 QECIGRWAGYCRGPHTHCATC 425 QEC+ W G+ + THC C Sbjct: 36 QECLVEWLGHSK--KTHCELC 54 >SPAC19A8.12 |dcp2||mRNA decapping complex subunit Dcp2|Schizosaccharomyces pombe|chr 1|||Manual Length = 741 Score = 25.0 bits (52), Expect = 8.4 Identities = 14/42 (33%), Positives = 20/42 (47%), Gaps = 1/42 (2%) Frame = +3 Query: 288 PSHAFIQGFFPTNSPHFSFF-IGKSRQECIGRWAGYCRGPHT 410 PS + Q F+P S S + +GK+ Q G + Y G T Sbjct: 410 PSTVYHQVFYPPTSTSVSSYGLGKTPQPAYGSSSPYVNGHQT 451 >SPAC3G9.13c |msw1||mitochondrial tryptophan-tRNA ligase Msw1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 361 Score = 25.0 bits (52), Expect = 8.4 Identities = 10/31 (32%), Positives = 15/31 (48%) Frame = +3 Query: 273 IXSIGPSHAFIQGFFPTNSPHFSFFIGKSRQ 365 I S+ P + G PT PH ++G +Q Sbjct: 7 ITSLLPHSRVVSGIQPTGIPHIGNYLGSLKQ 37 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,977,396 Number of Sequences: 5004 Number of extensions: 34758 Number of successful extensions: 61 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 60 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 61 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 260219058 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -