BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30834.Seq (698 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. 26 0.99 M93689-1|AAA29368.1| 442|Anopheles gambiae protein ( Anopheles ... 26 1.3 AY301275-1|AAQ67361.1| 611|Anopheles gambiae G-protein coupled ... 24 4.0 AJ439353-2|CAD27924.1| 612|Anopheles gambiae putative G-protein... 24 4.0 AJ441131-3|CAD29632.1| 568|Anopheles gambiae putative apyrase/n... 24 5.3 AJ439398-2|CAD28125.1| 568|Anopheles gambiae putative 5' nucleo... 24 5.3 AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative different... 23 7.0 AJ439060-18|CAD27769.1| 257|Anopheles gambiae hypothetical prot... 23 9.2 AF002238-1|AAB97731.1| 327|Anopheles gambiae ribosomal protein ... 23 9.2 >AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. Length = 3398 Score = 26.2 bits (55), Expect = 0.99 Identities = 12/44 (27%), Positives = 21/44 (47%) Frame = +1 Query: 10 HSILYNFSCPSTNFNTLNQYGRSKSASRRHWSTKRHPSLESSHH 141 HS+ Y +++F + Y ++ STKR P E S++ Sbjct: 2079 HSLRYPMDSAASSFTLIYDYNKNGEVKSIKESTKRVPMFEFSYN 2122 >M93689-1|AAA29368.1| 442|Anopheles gambiae protein ( Anopheles gambiae T1 retroposon. ). Length = 442 Score = 25.8 bits (54), Expect = 1.3 Identities = 14/51 (27%), Positives = 22/51 (43%) Frame = +3 Query: 234 CRHSTKRTRERCDFSAAATSKNSSTRDLPLAGFHGEVLPGGQRSLFILFTH 386 C H T RT+ D SA N+ + P+ H G +++ FT+ Sbjct: 211 CNHYTHRTKVTSDISAGPCRTNTKSSSDPVLN-HDTTNTGIAEKVWLYFTN 260 >AY301275-1|AAQ67361.1| 611|Anopheles gambiae G-protein coupled receptor protein. Length = 611 Score = 24.2 bits (50), Expect = 4.0 Identities = 11/31 (35%), Positives = 20/31 (64%) Frame = +1 Query: 367 YLFYSLIFMNVVPNLLILVPIFLFALLHAAS 459 Y ++L+FM ++P LLIL+ +L + +S Sbjct: 349 YTTFTLVFMFIIP-LLILIGTYLSTFMTISS 378 >AJ439353-2|CAD27924.1| 612|Anopheles gambiae putative G-protein coupled receptor protein. Length = 612 Score = 24.2 bits (50), Expect = 4.0 Identities = 11/31 (35%), Positives = 20/31 (64%) Frame = +1 Query: 367 YLFYSLIFMNVVPNLLILVPIFLFALLHAAS 459 Y ++L+FM ++P LLIL+ +L + +S Sbjct: 350 YTTFTLVFMFIIP-LLILIGTYLSTFMTISS 379 >AJ441131-3|CAD29632.1| 568|Anopheles gambiae putative apyrase/nucleotidase protein. Length = 568 Score = 23.8 bits (49), Expect = 5.3 Identities = 17/57 (29%), Positives = 30/57 (52%), Gaps = 5/57 (8%) Frame = +1 Query: 289 HQRIPAREISLSRDFMAR--FFLEDSAHY---LFYSLIFMNVVPNLLILVPIFLFAL 444 + R+ +R SL R++ R +L ++ L+YSL+ NV + L L+P + L Sbjct: 82 YARVVSRVKSLQREYADRNPIYLNAGDNFQGTLWYSLLRWNVTAHFLNLLPADVMTL 138 >AJ439398-2|CAD28125.1| 568|Anopheles gambiae putative 5' nucleotidase protein. Length = 568 Score = 23.8 bits (49), Expect = 5.3 Identities = 17/57 (29%), Positives = 30/57 (52%), Gaps = 5/57 (8%) Frame = +1 Query: 289 HQRIPAREISLSRDFMAR--FFLEDSAHY---LFYSLIFMNVVPNLLILVPIFLFAL 444 + R+ +R SL R++ R +L ++ L+YSL+ NV + L L+P + L Sbjct: 82 YARVVSRVKSLQREYADRNPIYLNAGDNFQGTLWYSLLRWNVTAHFLNLLPADVMTL 138 >AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative differentiation regulator protein. Length = 1283 Score = 23.4 bits (48), Expect = 7.0 Identities = 9/30 (30%), Positives = 15/30 (50%) Frame = +2 Query: 539 VAEHPSGPRALAEIVLXPVVLHHGHCSVTA 628 +++HP G + V+ P HH +V A Sbjct: 844 LSQHPPGASGRSSAVITPPSTHHQAAAVAA 873 >AJ439060-18|CAD27769.1| 257|Anopheles gambiae hypothetical protein protein. Length = 257 Score = 23.0 bits (47), Expect = 9.2 Identities = 12/35 (34%), Positives = 17/35 (48%) Frame = +1 Query: 103 STKRHPSLESSHHCQ*NRRSSLGGPRNHRAVYHWI 207 S R P + H Q RRSS R R+V +++ Sbjct: 60 SKNRMPPVPPPKHSQRRRRSSSPRTRQFRSVCYYV 94 >AF002238-1|AAB97731.1| 327|Anopheles gambiae ribosomal protein L5 protein. Length = 327 Score = 23.0 bits (47), Expect = 9.2 Identities = 14/40 (35%), Positives = 19/40 (47%) Frame = -2 Query: 463 NTKRRVAAQIKRLAPILTNWARRS*K*VNRINSERCPPGR 344 N + A I+++ P N RRS + R S R PP R Sbjct: 238 NIYKNAHASIRKIPPSRRNPRRRSPRSGGRWPSCRSPPAR 277 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 723,641 Number of Sequences: 2352 Number of extensions: 15486 Number of successful extensions: 28 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 26 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 28 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 71086350 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -