BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30833.Seq (698 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex det... 25 0.52 DQ325090-1|ABD14104.1| 178|Apis mellifera complementary sex det... 25 0.69 DQ325082-1|ABD14096.1| 179|Apis mellifera complementary sex det... 25 0.69 AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex det... 25 0.69 AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex det... 25 0.69 AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex det... 25 0.69 AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex det... 25 0.69 AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex det... 25 0.69 DQ325081-1|ABD14095.1| 186|Apis mellifera complementary sex det... 24 1.2 DQ325080-1|ABD14094.1| 184|Apis mellifera complementary sex det... 24 1.2 DQ325079-1|ABD14093.1| 184|Apis mellifera complementary sex det... 24 1.2 DQ325078-1|ABD14092.1| 184|Apis mellifera complementary sex det... 24 1.2 AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex det... 24 1.2 DQ325130-1|ABD14144.1| 174|Apis mellifera complementary sex det... 23 2.1 DQ325129-1|ABD14143.1| 174|Apis mellifera complementary sex det... 23 2.1 DQ325128-1|ABD14142.1| 174|Apis mellifera complementary sex det... 23 2.1 DQ325127-1|ABD14141.1| 174|Apis mellifera complementary sex det... 23 2.1 DQ325126-1|ABD14140.1| 174|Apis mellifera complementary sex det... 23 2.1 DQ325125-1|ABD14139.1| 174|Apis mellifera complementary sex det... 23 2.1 DQ325109-1|ABD14123.1| 177|Apis mellifera complementary sex det... 23 2.1 DQ325108-1|ABD14122.1| 177|Apis mellifera complementary sex det... 23 2.1 DQ325107-1|ABD14121.1| 176|Apis mellifera complementary sex det... 23 2.1 DQ325106-1|ABD14120.1| 177|Apis mellifera complementary sex det... 23 2.1 AY769960-1|AAV34676.1| 603|Apis mellifera soluble guanylyl cycl... 23 2.1 AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex det... 23 2.1 AB181489-1|BAD22772.1| 603|Apis mellifera soluble guanylyl cycl... 23 2.1 DQ325121-1|ABD14135.1| 181|Apis mellifera complementary sex det... 23 2.8 DQ325120-1|ABD14134.1| 181|Apis mellifera complementary sex det... 23 2.8 DQ325119-1|ABD14133.1| 181|Apis mellifera complementary sex det... 23 2.8 DQ325118-1|ABD14132.1| 181|Apis mellifera complementary sex det... 23 2.8 DQ325117-1|ABD14131.1| 181|Apis mellifera complementary sex det... 23 2.8 DQ325116-1|ABD14130.1| 181|Apis mellifera complementary sex det... 23 2.8 DQ325114-1|ABD14128.1| 181|Apis mellifera complementary sex det... 23 2.8 AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex det... 23 2.8 AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex det... 23 3.7 DQ325102-1|ABD14116.1| 183|Apis mellifera complementary sex det... 22 6.4 DQ325101-1|ABD14115.1| 182|Apis mellifera complementary sex det... 22 6.4 DQ325100-1|ABD14114.1| 183|Apis mellifera complementary sex det... 22 6.4 DQ325099-1|ABD14113.1| 183|Apis mellifera complementary sex det... 22 6.4 DQ325098-1|ABD14112.1| 183|Apis mellifera complementary sex det... 22 6.4 DQ325097-1|ABD14111.1| 183|Apis mellifera complementary sex det... 22 6.4 DQ325096-1|ABD14110.1| 183|Apis mellifera complementary sex det... 22 6.4 DQ325095-1|ABD14109.1| 183|Apis mellifera complementary sex det... 22 6.4 AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex det... 22 6.4 AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex det... 22 6.4 U70841-1|AAC47455.1| 377|Apis mellifera ultraviolet sensitive o... 21 8.5 EF493864-1|ABP65286.1| 247|Apis mellifera triosephoshpate isome... 21 8.5 AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein ... 21 8.5 AF004168-1|AAC13417.1| 377|Apis mellifera blue-sensitive opsin ... 21 8.5 >AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex determiner protein. Length = 385 Score = 25.4 bits (53), Expect = 0.52 Identities = 12/44 (27%), Positives = 22/44 (50%) Frame = +3 Query: 177 MLHGAATANLWHRNTPRQQQSWLKKNSYQTSES*RNSRTGSRRE 308 +L + + R+ R+Q+S+ +NSY+ R+ RRE Sbjct: 262 LLEERTSRKRYSRSREREQKSYKNENSYRKYRETSKERSRDRRE 305 >DQ325090-1|ABD14104.1| 178|Apis mellifera complementary sex determiner protein. Length = 178 Score = 25.0 bits (52), Expect = 0.69 Identities = 12/51 (23%), Positives = 25/51 (49%) Frame = +3 Query: 177 MLHGAATANLWHRNTPRQQQSWLKKNSYQTSES*RNSRTGSRRELRCTRIP 329 +L + + R+ R+Q+S+ +NSY+ R+ R+E ++ P Sbjct: 29 LLEERTSRKRYSRSREREQKSYKNENSYRKYRETSKERSRDRKERERSKEP 79 >DQ325082-1|ABD14096.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 25.0 bits (52), Expect = 0.69 Identities = 13/51 (25%), Positives = 24/51 (47%) Frame = +3 Query: 177 MLHGAATANLWHRNTPRQQQSWLKKNSYQTSES*RNSRTGSRRELRCTRIP 329 +L + + R+ R+Q+S+ +NSY+ R+ R E +R P Sbjct: 29 LLEERTSRKRYSRSREREQKSYKNENSYRKYRETSKERSRDRTERERSREP 79 >AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex determiner protein. Length = 419 Score = 25.0 bits (52), Expect = 0.69 Identities = 12/51 (23%), Positives = 25/51 (49%) Frame = +3 Query: 177 MLHGAATANLWHRNTPRQQQSWLKKNSYQTSES*RNSRTGSRRELRCTRIP 329 +L + + R+ R+Q+S+ +NSY+ R+ R+E ++ P Sbjct: 262 LLEERTSRKRYSRSREREQKSYKNENSYRKYRETSKERSRDRKERERSKEP 312 >AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 25.0 bits (52), Expect = 0.69 Identities = 13/51 (25%), Positives = 24/51 (47%) Frame = +3 Query: 177 MLHGAATANLWHRNTPRQQQSWLKKNSYQTSES*RNSRTGSRRELRCTRIP 329 +L + + R+ R+Q+S+ +NSY+ R+ R E +R P Sbjct: 251 LLEERTSRKRYSRSREREQKSYKNENSYRKYRETSKERSRDRTERERSREP 301 >AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 25.0 bits (52), Expect = 0.69 Identities = 13/51 (25%), Positives = 24/51 (47%) Frame = +3 Query: 177 MLHGAATANLWHRNTPRQQQSWLKKNSYQTSES*RNSRTGSRRELRCTRIP 329 +L + + R+ R+Q+S+ +NSY+ R+ R E +R P Sbjct: 262 LLEERTSRKRYSRSREREQKSYKNENSYRKYRETSKERSRDRTERERSREP 312 >AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 25.0 bits (52), Expect = 0.69 Identities = 13/51 (25%), Positives = 24/51 (47%) Frame = +3 Query: 177 MLHGAATANLWHRNTPRQQQSWLKKNSYQTSES*RNSRTGSRRELRCTRIP 329 +L + + R+ R+Q+S+ +NSY+ R+ R E +R P Sbjct: 262 LLEERTSRKRYSRSREREQKSYKNENSYRKYRETSKERSRDRTERERSREP 312 >AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 25.0 bits (52), Expect = 0.69 Identities = 13/51 (25%), Positives = 24/51 (47%) Frame = +3 Query: 177 MLHGAATANLWHRNTPRQQQSWLKKNSYQTSES*RNSRTGSRRELRCTRIP 329 +L + + R+ R+Q+S+ +NSY+ R+ R E +R P Sbjct: 251 LLEERTSRKRYSRSREREQKSYKNENSYRKYRETSKERSRDRTERERSREP 301 >DQ325081-1|ABD14095.1| 186|Apis mellifera complementary sex determiner protein. Length = 186 Score = 24.2 bits (50), Expect = 1.2 Identities = 13/51 (25%), Positives = 24/51 (47%) Frame = +3 Query: 177 MLHGAATANLWHRNTPRQQQSWLKKNSYQTSES*RNSRTGSRRELRCTRIP 329 +L + + R+ R+Q+S+ +NSY+ R+ R E +R P Sbjct: 29 LLEERTSRKRYSRSREREQKSYKNENSYRKYRETWKERSRDRTERERSREP 79 >DQ325080-1|ABD14094.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 24.2 bits (50), Expect = 1.2 Identities = 13/51 (25%), Positives = 24/51 (47%) Frame = +3 Query: 177 MLHGAATANLWHRNTPRQQQSWLKKNSYQTSES*RNSRTGSRRELRCTRIP 329 +L + + R+ R+Q+S+ +NSY+ R+ R E +R P Sbjct: 29 LLEERTSRKRYSRSREREQKSYKNENSYRKYRETWKERSRDRTERERSREP 79 >DQ325079-1|ABD14093.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 24.2 bits (50), Expect = 1.2 Identities = 13/51 (25%), Positives = 24/51 (47%) Frame = +3 Query: 177 MLHGAATANLWHRNTPRQQQSWLKKNSYQTSES*RNSRTGSRRELRCTRIP 329 +L + + R+ R+Q+S+ +NSY+ R+ R E +R P Sbjct: 29 LLEERTSRKRYSRSREREQKSYKNENSYRKYRETWKERSRDRTERERSREP 79 >DQ325078-1|ABD14092.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 24.2 bits (50), Expect = 1.2 Identities = 13/51 (25%), Positives = 24/51 (47%) Frame = +3 Query: 177 MLHGAATANLWHRNTPRQQQSWLKKNSYQTSES*RNSRTGSRRELRCTRIP 329 +L + + R+ R+Q+S+ +NSY+ R+ R E +R P Sbjct: 29 LLEERTSRKRYSRSREREQKSYKNENSYRKYRETWKERSRDRTERERSREP 79 >AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 24.2 bits (50), Expect = 1.2 Identities = 13/51 (25%), Positives = 24/51 (47%) Frame = +3 Query: 177 MLHGAATANLWHRNTPRQQQSWLKKNSYQTSES*RNSRTGSRRELRCTRIP 329 +L + + R+ R+Q+S+ +NSY+ R+ R E +R P Sbjct: 262 LLEERTSRKRYSRSREREQRSYKNENSYRKYRETSKERSRDRIERERSREP 312 >DQ325130-1|ABD14144.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 23.4 bits (48), Expect = 2.1 Identities = 11/41 (26%), Positives = 21/41 (51%) Frame = +3 Query: 207 WHRNTPRQQQSWLKKNSYQTSES*RNSRTGSRRELRCTRIP 329 + R+ R+Q+S+ +NSY+ R+ R E ++ P Sbjct: 39 YSRSREREQKSYKNENSYRKYRKTSKERSRDRTERERSKEP 79 >DQ325129-1|ABD14143.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 23.4 bits (48), Expect = 2.1 Identities = 11/41 (26%), Positives = 21/41 (51%) Frame = +3 Query: 207 WHRNTPRQQQSWLKKNSYQTSES*RNSRTGSRRELRCTRIP 329 + R+ R+Q+S+ +NSY+ R+ R E ++ P Sbjct: 39 YSRSREREQKSYKNENSYRKYRKTSKERSRDRTERERSKEP 79 >DQ325128-1|ABD14142.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 23.4 bits (48), Expect = 2.1 Identities = 11/41 (26%), Positives = 21/41 (51%) Frame = +3 Query: 207 WHRNTPRQQQSWLKKNSYQTSES*RNSRTGSRRELRCTRIP 329 + R+ R+Q+S+ +NSY+ R+ R E ++ P Sbjct: 39 YSRSREREQKSYKNENSYRKYRKTSKERSRDRTERERSKEP 79 >DQ325127-1|ABD14141.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 23.4 bits (48), Expect = 2.1 Identities = 11/41 (26%), Positives = 21/41 (51%) Frame = +3 Query: 207 WHRNTPRQQQSWLKKNSYQTSES*RNSRTGSRRELRCTRIP 329 + R+ R+Q+S+ +NSY+ R+ R E ++ P Sbjct: 39 YSRSREREQKSYKNENSYRKYRKTSKERSRDRTERERSKEP 79 >DQ325126-1|ABD14140.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 23.4 bits (48), Expect = 2.1 Identities = 11/41 (26%), Positives = 21/41 (51%) Frame = +3 Query: 207 WHRNTPRQQQSWLKKNSYQTSES*RNSRTGSRRELRCTRIP 329 + R+ R+Q+S+ +NSY+ R+ R E ++ P Sbjct: 39 YSRSREREQKSYKNENSYRKYRKTSKERSRDRTERERSKEP 79 >DQ325125-1|ABD14139.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 23.4 bits (48), Expect = 2.1 Identities = 11/41 (26%), Positives = 21/41 (51%) Frame = +3 Query: 207 WHRNTPRQQQSWLKKNSYQTSES*RNSRTGSRRELRCTRIP 329 + R+ R+Q+S+ +NSY+ R+ R E ++ P Sbjct: 39 YSRSREREQKSYKNENSYRKYRKTSKERSRDRTERERSKEP 79 >DQ325109-1|ABD14123.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 23.4 bits (48), Expect = 2.1 Identities = 11/51 (21%), Positives = 25/51 (49%) Frame = +3 Query: 177 MLHGAATANLWHRNTPRQQQSWLKKNSYQTSES*RNSRTGSRRELRCTRIP 329 +L + + R+ R+++S+ +NSY+ R+ R+E ++ P Sbjct: 29 LLEERTSRKRYSRSREREKKSYKNENSYRKYRETSKERSRDRKERERSKEP 79 >DQ325108-1|ABD14122.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 23.4 bits (48), Expect = 2.1 Identities = 11/51 (21%), Positives = 25/51 (49%) Frame = +3 Query: 177 MLHGAATANLWHRNTPRQQQSWLKKNSYQTSES*RNSRTGSRRELRCTRIP 329 +L + + R+ R+++S+ +NSY+ R+ R+E ++ P Sbjct: 29 LLEERTSRKRYSRSREREKKSYKNENSYRKYRETSKERSRDRKERERSKEP 79 >DQ325107-1|ABD14121.1| 176|Apis mellifera complementary sex determiner protein. Length = 176 Score = 23.4 bits (48), Expect = 2.1 Identities = 11/51 (21%), Positives = 25/51 (49%) Frame = +3 Query: 177 MLHGAATANLWHRNTPRQQQSWLKKNSYQTSES*RNSRTGSRRELRCTRIP 329 +L + + R+ R+++S+ +NSY+ R+ R+E ++ P Sbjct: 29 LLEERTSRKRYSRSREREKKSYKNENSYRKYRETSKERSRDRKERERSKEP 79 >DQ325106-1|ABD14120.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 23.4 bits (48), Expect = 2.1 Identities = 11/51 (21%), Positives = 25/51 (49%) Frame = +3 Query: 177 MLHGAATANLWHRNTPRQQQSWLKKNSYQTSES*RNSRTGSRRELRCTRIP 329 +L + + R+ R+++S+ +NSY+ R+ R+E ++ P Sbjct: 29 LLEERTSRKRYSRSREREKKSYKNENSYRKYRETSKERSRDRKERERSKEP 79 >AY769960-1|AAV34676.1| 603|Apis mellifera soluble guanylyl cyclase beta 1 subunit protein. Length = 603 Score = 23.4 bits (48), Expect = 2.1 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = -1 Query: 212 VPEICSGRTMEHRIQLKCTPWL*LQFQS 129 +P++CSG + I L P L L F++ Sbjct: 238 IPQVCSGNCKLNDILLTVRPHLELTFEN 265 >AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex determiner protein. Length = 410 Score = 23.4 bits (48), Expect = 2.1 Identities = 11/51 (21%), Positives = 25/51 (49%) Frame = +3 Query: 177 MLHGAATANLWHRNTPRQQQSWLKKNSYQTSES*RNSRTGSRRELRCTRIP 329 +L + + R+ R+++S+ +NSY+ R+ R+E ++ P Sbjct: 262 LLEERTSRKRYSRSREREKKSYKNENSYRKYRETSKERSRDRKERERSKEP 312 >AB181489-1|BAD22772.1| 603|Apis mellifera soluble guanylyl cyclase beta 1 subunit protein. Length = 603 Score = 23.4 bits (48), Expect = 2.1 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = -1 Query: 212 VPEICSGRTMEHRIQLKCTPWL*LQFQS 129 +P++CSG + I L P L L F++ Sbjct: 238 IPQVCSGNCKLNDILLTVRPHLELTFEN 265 >DQ325121-1|ABD14135.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.0 bits (47), Expect = 2.8 Identities = 13/48 (27%), Positives = 21/48 (43%), Gaps = 1/48 (2%) Frame = +3 Query: 177 MLHGAATANLWHRNTPRQQQSWLKKNSYQTSES*RNSRTGSRREL-RC 317 +L + N + R+ R+Q S+ + YQ R+ R E RC Sbjct: 29 LLEERTSRNRYSRSREREQNSYKNEREYQKYRETSKERSRDRTERERC 76 >DQ325120-1|ABD14134.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.0 bits (47), Expect = 2.8 Identities = 13/48 (27%), Positives = 21/48 (43%), Gaps = 1/48 (2%) Frame = +3 Query: 177 MLHGAATANLWHRNTPRQQQSWLKKNSYQTSES*RNSRTGSRREL-RC 317 +L + N + R+ R+Q S+ + YQ R+ R E RC Sbjct: 29 LLEERTSRNRYSRSREREQNSYKNEREYQKYRETSKERSRDRTERERC 76 >DQ325119-1|ABD14133.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.0 bits (47), Expect = 2.8 Identities = 13/48 (27%), Positives = 21/48 (43%), Gaps = 1/48 (2%) Frame = +3 Query: 177 MLHGAATANLWHRNTPRQQQSWLKKNSYQTSES*RNSRTGSRREL-RC 317 +L + N + R+ R+Q S+ + YQ R+ R E RC Sbjct: 29 LLEERTSRNRYSRSREREQNSYKNEREYQKYRETSKERSRDRTERERC 76 >DQ325118-1|ABD14132.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.0 bits (47), Expect = 2.8 Identities = 13/48 (27%), Positives = 21/48 (43%), Gaps = 1/48 (2%) Frame = +3 Query: 177 MLHGAATANLWHRNTPRQQQSWLKKNSYQTSES*RNSRTGSRREL-RC 317 +L + N + R+ R+Q S+ + YQ R+ R E RC Sbjct: 29 LLEERTSRNRYSRSREREQNSYKNEREYQKYRETSKERSRDRTERERC 76 >DQ325117-1|ABD14131.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.0 bits (47), Expect = 2.8 Identities = 13/48 (27%), Positives = 21/48 (43%), Gaps = 1/48 (2%) Frame = +3 Query: 177 MLHGAATANLWHRNTPRQQQSWLKKNSYQTSES*RNSRTGSRREL-RC 317 +L + N + R+ R+Q S+ + YQ R+ R E RC Sbjct: 29 LLEERTSRNRYSRSREREQNSYKNEREYQKYRETSKERSRDRTERERC 76 >DQ325116-1|ABD14130.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.0 bits (47), Expect = 2.8 Identities = 13/48 (27%), Positives = 21/48 (43%), Gaps = 1/48 (2%) Frame = +3 Query: 177 MLHGAATANLWHRNTPRQQQSWLKKNSYQTSES*RNSRTGSRREL-RC 317 +L + N + R+ R+Q S+ + YQ R+ R E RC Sbjct: 29 LLEERTSRNRYSRSREREQNSYKNEREYQKYRETSKERSRDRTERERC 76 >DQ325114-1|ABD14128.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.0 bits (47), Expect = 2.8 Identities = 13/48 (27%), Positives = 21/48 (43%), Gaps = 1/48 (2%) Frame = +3 Query: 177 MLHGAATANLWHRNTPRQQQSWLKKNSYQTSES*RNSRTGSRREL-RC 317 +L + N + R+ R+Q S+ + YQ R+ R E RC Sbjct: 29 LLEERTSRNRYSRSREREQNSYKNEREYQKYRETSKERSRDRTERERC 76 >AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex determiner protein. Length = 413 Score = 23.0 bits (47), Expect = 2.8 Identities = 11/44 (25%), Positives = 21/44 (47%) Frame = +3 Query: 177 MLHGAATANLWHRNTPRQQQSWLKKNSYQTSES*RNSRTGSRRE 308 +L + + R+ R+Q+S+ +NSY+ R+ R E Sbjct: 262 LLEERTSRKRYSRSREREQKSYKNENSYRKYRETSKERSRDRTE 305 >AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex determiner protein. Length = 428 Score = 22.6 bits (46), Expect = 3.7 Identities = 11/35 (31%), Positives = 18/35 (51%) Frame = +3 Query: 225 RQQQSWLKKNSYQTSES*RNSRTGSRRELRCTRIP 329 R+Q+S+ +NSY+ R+ R E +R P Sbjct: 278 REQKSYKNENSYRKYRETSKERSRDRTERERSREP 312 >DQ325102-1|ABD14116.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 21.8 bits (44), Expect = 6.4 Identities = 11/51 (21%), Positives = 22/51 (43%) Frame = +3 Query: 177 MLHGAATANLWHRNTPRQQQSWLKKNSYQTSES*RNSRTGSRRELRCTRIP 329 +L + + R+ R+Q S+ + Y+ R+ RRE ++ P Sbjct: 29 LLEERTSRKRYSRSREREQNSYKNEREYRKYRETSKERSRDRRERERSKEP 79 >DQ325101-1|ABD14115.1| 182|Apis mellifera complementary sex determiner protein. Length = 182 Score = 21.8 bits (44), Expect = 6.4 Identities = 11/51 (21%), Positives = 22/51 (43%) Frame = +3 Query: 177 MLHGAATANLWHRNTPRQQQSWLKKNSYQTSES*RNSRTGSRRELRCTRIP 329 +L + + R+ R+Q S+ + Y+ R+ RRE ++ P Sbjct: 29 LLEERTSRKRYSRSREREQNSYKNEREYRKYRETSKERSRDRRERERSKEP 79 >DQ325100-1|ABD14114.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 21.8 bits (44), Expect = 6.4 Identities = 11/51 (21%), Positives = 22/51 (43%) Frame = +3 Query: 177 MLHGAATANLWHRNTPRQQQSWLKKNSYQTSES*RNSRTGSRRELRCTRIP 329 +L + + R+ R+Q S+ + Y+ R+ RRE ++ P Sbjct: 29 LLEERTSRKRYSRSREREQNSYKNEREYRKYRETSKERSRDRRERERSKEP 79 >DQ325099-1|ABD14113.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 21.8 bits (44), Expect = 6.4 Identities = 11/51 (21%), Positives = 22/51 (43%) Frame = +3 Query: 177 MLHGAATANLWHRNTPRQQQSWLKKNSYQTSES*RNSRTGSRRELRCTRIP 329 +L + + R+ R+Q S+ + Y+ R+ RRE ++ P Sbjct: 29 LLEERTSRKRYSRSREREQNSYKNEREYRKYRETSKERSRDRRERERSKEP 79 >DQ325098-1|ABD14112.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 21.8 bits (44), Expect = 6.4 Identities = 11/51 (21%), Positives = 22/51 (43%) Frame = +3 Query: 177 MLHGAATANLWHRNTPRQQQSWLKKNSYQTSES*RNSRTGSRRELRCTRIP 329 +L + + R+ R+Q S+ + Y+ R+ RRE ++ P Sbjct: 29 LLEERTSRKRYSRSREREQNSYKNEREYRKYRETSKERSRDRRERERSKEP 79 >DQ325097-1|ABD14111.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 21.8 bits (44), Expect = 6.4 Identities = 11/51 (21%), Positives = 22/51 (43%) Frame = +3 Query: 177 MLHGAATANLWHRNTPRQQQSWLKKNSYQTSES*RNSRTGSRRELRCTRIP 329 +L + + R+ R+Q S+ + Y+ R+ RRE ++ P Sbjct: 29 LLEERTSRKRYSRSREREQNSYKNEREYRKYRETSKERSRDRRERERSKEP 79 >DQ325096-1|ABD14110.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 21.8 bits (44), Expect = 6.4 Identities = 11/51 (21%), Positives = 22/51 (43%) Frame = +3 Query: 177 MLHGAATANLWHRNTPRQQQSWLKKNSYQTSES*RNSRTGSRRELRCTRIP 329 +L + + R+ R+Q S+ + Y+ R+ RRE ++ P Sbjct: 29 LLEERTSRKRYSRSREREQNSYKNEREYRKYRETSKERSRDRRERERSKEP 79 >DQ325095-1|ABD14109.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 21.8 bits (44), Expect = 6.4 Identities = 11/51 (21%), Positives = 22/51 (43%) Frame = +3 Query: 177 MLHGAATANLWHRNTPRQQQSWLKKNSYQTSES*RNSRTGSRRELRCTRIP 329 +L + + R+ R+Q S+ + Y+ R+ RRE ++ P Sbjct: 29 LLEERTSRKRYSRSREREQNSYKNEREYRKYRETSKERSRDRRERERSKEP 79 >AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 21.8 bits (44), Expect = 6.4 Identities = 11/51 (21%), Positives = 22/51 (43%) Frame = +3 Query: 177 MLHGAATANLWHRNTPRQQQSWLKKNSYQTSES*RNSRTGSRRELRCTRIP 329 +L + + R+ R+Q S+ + Y+ R+ RRE ++ P Sbjct: 251 LLEERTSRKRYSRSREREQNSYKNEREYRKYRETSKERSRDRRERERSKEP 301 >AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex determiner protein. Length = 418 Score = 21.8 bits (44), Expect = 6.4 Identities = 10/44 (22%), Positives = 21/44 (47%) Frame = +3 Query: 177 MLHGAATANLWHRNTPRQQQSWLKKNSYQTSES*RNSRTGSRRE 308 +L + + R+ R+Q+S+ +NSY+ R+ + E Sbjct: 267 LLEERTSRKRYSRSREREQKSYKNENSYRKYRETSKERSRDKTE 310 >U70841-1|AAC47455.1| 377|Apis mellifera ultraviolet sensitive opsin protein. Length = 377 Score = 21.4 bits (43), Expect = 8.5 Identities = 10/41 (24%), Positives = 20/41 (48%) Frame = -3 Query: 531 FGSG*ALVEKKPNTITVLASISSLACSARGDLNSRXASLLL 409 FGS + + N +++C G LNS+ A++++ Sbjct: 135 FGSISGMGQAMTNAAIAFDRYRTISCPIDGRLNSKQAAVII 175 >EF493864-1|ABP65286.1| 247|Apis mellifera triosephoshpate isomerase protein. Length = 247 Score = 21.4 bits (43), Expect = 8.5 Identities = 13/38 (34%), Positives = 18/38 (47%) Frame = +1 Query: 337 KFFRNGSXIDYSGGRQADDIISWLKKKTGPPAVEVTSG 450 KFF G+ + +DI+ +LKK VEV G Sbjct: 4 KFFVGGNWKMNGTKSEINDIVGFLKKGPLDSNVEVVVG 41 >AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein 1 protein. Length = 500 Score = 21.4 bits (43), Expect = 8.5 Identities = 6/11 (54%), Positives = 9/11 (81%) Frame = +1 Query: 454 TG*RTYRCQYC 486 TG + Y+C+YC Sbjct: 115 TGEKPYQCEYC 125 >AF004168-1|AAC13417.1| 377|Apis mellifera blue-sensitive opsin protein. Length = 377 Score = 21.4 bits (43), Expect = 8.5 Identities = 10/41 (24%), Positives = 20/41 (48%) Frame = -3 Query: 531 FGSG*ALVEKKPNTITVLASISSLACSARGDLNSRXASLLL 409 FGS + + N +++C G LNS+ A++++ Sbjct: 135 FGSISGMGQAMTNAAIAFDRYRTISCPIDGRLNSKQAAVII 175 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 173,891 Number of Sequences: 438 Number of extensions: 3159 Number of successful extensions: 68 Number of sequences better than 10.0: 49 Number of HSP's better than 10.0 without gapping: 68 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 68 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21439440 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -