BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30833.Seq (698 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g60640.2 68418.m07611 thioredoxin family protein similar to p... 80 1e-15 At5g60640.1 68418.m07610 thioredoxin family protein similar to p... 80 1e-15 At1g21750.2 68414.m02723 protein disulfide isomerase, putative s... 74 1e-13 At1g21750.1 68414.m02722 protein disulfide isomerase, putative s... 74 1e-13 At1g77510.1 68414.m09026 protein disulfide isomerase, putative s... 71 6e-13 At2g47470.2 68415.m05924 thioredoxin family protein similar to p... 69 3e-12 At2g47470.1 68415.m05925 thioredoxin family protein similar to p... 69 3e-12 At3g54960.1 68416.m06094 thioredoxin family protein similar to p... 64 6e-11 At1g52260.1 68414.m05897 thioredoxin family protein similar to p... 63 1e-10 At1g35620.1 68414.m04425 thioredoxin family protein similar to S... 62 5e-10 At1g04980.1 68414.m00497 thioredoxin family protein similar to S... 58 4e-09 At2g32920.1 68415.m04036 thioredoxin family protein similar to S... 56 2e-08 At3g16110.1 68416.m02035 thioredoxin family protein similar to p... 54 9e-08 At4g27080.1 68417.m03893 thioredoxin family protein contains Pfa... 46 2e-05 At2g01270.1 68415.m00040 thioredoxin family protein low similari... 42 4e-04 At1g69880.1 68414.m08042 thioredoxin, putative similar to SP|Q38... 42 4e-04 At1g15020.2 68414.m01795 thioredoxin family protein low similari... 41 7e-04 At1g15020.1 68414.m01794 thioredoxin family protein low similari... 41 7e-04 At1g62180.1 68414.m07014 5'-adenylylsulfate reductase 2, chlorop... 41 0.001 At4g37200.1 68417.m05266 thioredoxin family protein contains Pfa... 40 0.002 At2g33270.1 68415.m04078 thioredoxin family protein contains Pfa... 39 0.003 At1g59730.1 68414.m06725 thioredoxin, putative similar to SP|Q38... 39 0.004 At1g03680.1 68414.m00347 thioredoxin M-type 1, chloroplast (TRX-... 38 0.005 At1g19730.1 68414.m02465 thioredoxin H-type 4 (TRX-H-4) (GREN) i... 38 0.008 At4g04610.1 68417.m00674 5'-adenylylsulfate reductase (APR1) / P... 37 0.011 At4g03520.1 68417.m00480 thioredoxin M-type 2, chloroplast (TRX-... 37 0.011 At3g15360.1 68416.m01948 thioredoxin M-type 4, chloroplast (TRX-... 37 0.011 At1g50950.1 68414.m05728 thioredoxin-related contains weak hit t... 37 0.011 At3g51030.1 68416.m05587 thioredoxin H-type 1 (TRX-H-1) identica... 37 0.015 At3g20560.1 68416.m02603 thioredoxin family protein contains Pfa... 37 0.015 At5g16400.1 68418.m01917 thioredoxin, putative similar to SP|P29... 36 0.020 At5g61440.1 68418.m07709 thioredoxin family protein low similari... 36 0.026 At4g29670.2 68417.m04227 thioredoxin family protein contains Pfa... 36 0.026 At4g29670.1 68417.m04226 thioredoxin family protein contains Pfa... 36 0.026 At4g21990.1 68417.m03183 5'-adenylylsulfate reductase (APR3) / P... 36 0.034 At3g02730.1 68416.m00265 thioredoxin, putative similar to SP|P29... 35 0.045 At1g50320.1 68414.m05641 thioredoxin x nearly identical to thior... 35 0.045 At4g26160.1 68417.m03765 thioredoxin family protein low similari... 35 0.060 At1g34780.1 68414.m04329 protein disulfide isomerase-related con... 34 0.10 At5g39950.1 68418.m04844 thioredoxin H-type 2 (TRX-H-2) (Gif2) i... 33 0.14 At1g45145.1 68414.m05175 thioredoxin H-type 5 (TRX-H-5) (TOUL) i... 33 0.14 At3g17880.1 68416.m02278 tetratricoredoxin (TDX) identical to te... 33 0.24 At1g76760.1 68414.m08933 thioredoxin family protein similar to t... 33 0.24 At1g08570.1 68414.m00950 thioredoxin family protein contains Pfa... 33 0.24 At1g43560.1 68414.m05000 thioredoxin family protein contains Pfa... 32 0.32 At4g04950.1 68417.m00719 thioredoxin family protein similar to P... 32 0.42 At4g08930.1 68417.m01470 thioredoxin-related contains weak simil... 31 0.56 At3g19780.1 68416.m02504 expressed protein 31 0.56 At2g15570.1 68415.m01783 thioredoxin M-type 3, chloroplast (TRX-... 31 0.73 At5g42980.1 68418.m05242 thioredoxin H-type 3 (TRX-H-3) (GIF1) i... 31 0.97 At3g08710.1 68416.m01012 thioredoxin family protein similar to t... 31 0.97 At4g32580.1 68417.m04638 thioredoxin family protein contains Pfa... 30 1.3 At3g06730.1 68416.m00798 thioredoxin family protein contains Pfa... 30 1.3 At1g52990.1 68414.m05997 thioredoxin family protein similar to S... 29 2.2 At1g07960.3 68414.m00867 thioredoxin family protein low similari... 29 2.2 At1g07960.2 68414.m00866 thioredoxin family protein low similari... 29 2.2 At1g07960.1 68414.m00865 thioredoxin family protein low similari... 29 2.2 At3g63440.1 68416.m07143 FAD-binding domain-containing protein /... 29 3.0 At1g07700.3 68414.m00829 thioredoxin family protein low similari... 29 3.9 At1g07700.2 68414.m00827 thioredoxin family protein low similari... 29 3.9 At1g07700.1 68414.m00828 thioredoxin family protein low similari... 29 3.9 At4g14210.2 68417.m02193 phytoene dehydrogenase, chloroplast / p... 28 5.2 At4g14210.1 68417.m02192 phytoene dehydrogenase, chloroplast / p... 28 5.2 At3g53220.1 68416.m05864 thioredoxin family protein low similari... 28 5.2 At1g11530.1 68414.m01324 thioredoxin family protein similar to t... 28 5.2 At4g19520.1 68417.m02872 disease resistance protein (TIR-NBS-LRR... 28 6.8 At3g56420.1 68416.m06275 thioredoxin family protein similar to t... 27 9.0 At2g42580.1 68415.m05269 tetratricopeptide repeat (TPR)-containi... 27 9.0 At1g53300.1 68414.m06041 thioredoxin family protein contains Pfa... 27 9.0 >At5g60640.2 68418.m07611 thioredoxin family protein similar to protein disulfide isomerase GI:5902592 from [Volvox carteri f. nagariensis], GI:2708314 from Chlamydomonas reinhardtii; contains Pfam profile: PF00085 Thioredoxin Length = 536 Score = 80.2 bits (189), Expect = 1e-15 Identities = 37/66 (56%), Positives = 48/66 (72%), Gaps = 4/66 (6%) Frame = +2 Query: 65 LGLALGDEVPT----EENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAA 232 LG D +PT E++V+V+ + NF VI +Y+LVEFYAPWCGHC+SLAPEYA AA Sbjct: 87 LGNPDSDPLPTPEIDEKDVVVIKERNFTDVIENNQYVLVEFYAPWCGHCQSLAPEYAAAA 146 Query: 233 TKLAEE 250 T+L E+ Sbjct: 147 TELKED 152 Score = 72.5 bits (170), Expect = 2e-13 Identities = 30/63 (47%), Positives = 45/63 (71%) Frame = +1 Query: 259 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSXIDYSGGRQADDIISWLKKKTGPPAVE 438 + LAK+DAT+E +LA+ Y V+G+PTL FF +G Y+GGR + I++W+KKK GP Sbjct: 154 VVLAKIDATEENELAQEYRVQGFPTLLFFVDGEHKPYTGGRTKETIVTWVKKKIGPGVYN 213 Query: 439 VTS 447 +T+ Sbjct: 214 LTT 216 Score = 50.8 bits (116), Expect = 8e-07 Identities = 24/56 (42%), Positives = 36/56 (64%), Gaps = 3/56 (5%) Frame = +2 Query: 83 DEVP--TEENVLVLSKANF-ETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKL 241 D +P +E+V ++ NF E V+ ++ +L+E YAPWCGHC++L P Y K A L Sbjct: 433 DPIPEKNDEDVKIVVGDNFDEIVLDDSKDVLLEVYAPWCGHCQALEPMYNKLAKHL 488 >At5g60640.1 68418.m07610 thioredoxin family protein similar to protein disulfide isomerase GI:5902592 from [Volvox carteri f. nagariensis], GI:2708314 from Chlamydomonas reinhardtii; contains Pfam profile: PF00085 Thioredoxin Length = 597 Score = 80.2 bits (189), Expect = 1e-15 Identities = 37/66 (56%), Positives = 48/66 (72%), Gaps = 4/66 (6%) Frame = +2 Query: 65 LGLALGDEVPT----EENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAA 232 LG D +PT E++V+V+ + NF VI +Y+LVEFYAPWCGHC+SLAPEYA AA Sbjct: 87 LGNPDSDPLPTPEIDEKDVVVIKERNFTDVIENNQYVLVEFYAPWCGHCQSLAPEYAAAA 146 Query: 233 TKLAEE 250 T+L E+ Sbjct: 147 TELKED 152 Score = 72.5 bits (170), Expect = 2e-13 Identities = 30/63 (47%), Positives = 45/63 (71%) Frame = +1 Query: 259 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSXIDYSGGRQADDIISWLKKKTGPPAVE 438 + LAK+DAT+E +LA+ Y V+G+PTL FF +G Y+GGR + I++W+KKK GP Sbjct: 154 VVLAKIDATEENELAQEYRVQGFPTLLFFVDGEHKPYTGGRTKETIVTWVKKKIGPGVYN 213 Query: 439 VTS 447 +T+ Sbjct: 214 LTT 216 Score = 50.8 bits (116), Expect = 8e-07 Identities = 24/56 (42%), Positives = 36/56 (64%), Gaps = 3/56 (5%) Frame = +2 Query: 83 DEVP--TEENVLVLSKANF-ETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKL 241 D +P +E+V ++ NF E V+ ++ +L+E YAPWCGHC++L P Y K A L Sbjct: 433 DPIPEKNDEDVKIVVGDNFDEIVLDDSKDVLLEVYAPWCGHCQALEPMYNKLAKHL 488 >At1g21750.2 68414.m02723 protein disulfide isomerase, putative similar to SP|P29828 Protein disulfide isomerase precursor (PDI) (EC 5.3.4.1) {Medicago sativa}; isoform contains non-consensus GA donor splice site at intron 9 Length = 487 Score = 73.7 bits (173), Expect = 1e-13 Identities = 36/72 (50%), Positives = 46/72 (63%), Gaps = 6/72 (8%) Frame = +2 Query: 47 FTAIALLGLAL------GDEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSL 208 FT ++L L+L +E T+E VL L NF I ++I+VEFYAPWCGHCK L Sbjct: 6 FTLFSILVLSLCASSIRSEETETKEFVLTLDHTNFTDTINKHDFIVVEFYAPWCGHCKQL 65 Query: 209 APEYAKAATKLA 244 APEY KAA+ L+ Sbjct: 66 APEYEKAASALS 77 Score = 69.7 bits (163), Expect = 2e-12 Identities = 38/120 (31%), Positives = 70/120 (58%), Gaps = 5/120 (4%) Frame = +1 Query: 256 PIKLAKVDATQE--QDLAESYGVRGYPTLKFFRNGSXI--DYSGGRQADDIISWLKKKTG 423 P+ LAK+DA++E ++ A Y V+G+PT+K FRNG +Y+G R+A+ I+++LKK++G Sbjct: 82 PVVLAKIDASEETNREFATQYEVQGFPTIKIFRNGGKAVQEYNGPREAEGIVTYLKKQSG 141 Query: 424 PPAVEVTSG*TG*RTYRCQYCYCIWFLFDQSSARAKTFLSTAQVVDDQV-FAIVSDEKVI 600 P + E+ S + + S + +F++ A+ + ++ FA SD K++ Sbjct: 142 PASAEIKSADDASEVVSDKKVVVVGIFPKLSGSEFDSFMAIAEKLRSELDFAHTSDAKLL 201 Score = 48.0 bits (109), Expect = 6e-06 Identities = 20/45 (44%), Positives = 31/45 (68%), Gaps = 3/45 (6%) Frame = +2 Query: 89 VPTEENV---LVLSKANFETVITTTEYILVEFYAPWCGHCKSLAP 214 +P E N +V+S + + V+ + + +L+EFYAPWCGHC+ LAP Sbjct: 368 IPAENNEPVKVVVSDSLDDIVLNSGKNVLLEFYAPWCGHCQKLAP 412 Score = 35.5 bits (78), Expect = 0.034 Identities = 15/52 (28%), Positives = 32/52 (61%), Gaps = 1/52 (1%) Frame = +1 Query: 259 IKLAKVDATQEQDLAESYGVRGYPTLKF-FRNGSXIDYSGGRQADDIISWLK 411 + +AK+DAT +++ V+G+PT+ F +G+ + Y G RQ + + +++ Sbjct: 427 VVIAKLDATANDFPKDTFDVKGFPTIYFKSASGNVVVYEGDRQRESLYLFIR 478 >At1g21750.1 68414.m02722 protein disulfide isomerase, putative similar to SP|P29828 Protein disulfide isomerase precursor (PDI) (EC 5.3.4.1) {Medicago sativa}; isoform contains non-consensus GA donor splice site at intron 9 Length = 501 Score = 73.7 bits (173), Expect = 1e-13 Identities = 36/72 (50%), Positives = 46/72 (63%), Gaps = 6/72 (8%) Frame = +2 Query: 47 FTAIALLGLAL------GDEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSL 208 FT ++L L+L +E T+E VL L NF I ++I+VEFYAPWCGHCK L Sbjct: 6 FTLFSILVLSLCASSIRSEETETKEFVLTLDHTNFTDTINKHDFIVVEFYAPWCGHCKQL 65 Query: 209 APEYAKAATKLA 244 APEY KAA+ L+ Sbjct: 66 APEYEKAASALS 77 Score = 69.7 bits (163), Expect = 2e-12 Identities = 38/120 (31%), Positives = 70/120 (58%), Gaps = 5/120 (4%) Frame = +1 Query: 256 PIKLAKVDATQE--QDLAESYGVRGYPTLKFFRNGSXI--DYSGGRQADDIISWLKKKTG 423 P+ LAK+DA++E ++ A Y V+G+PT+K FRNG +Y+G R+A+ I+++LKK++G Sbjct: 82 PVVLAKIDASEETNREFATQYEVQGFPTIKIFRNGGKAVQEYNGPREAEGIVTYLKKQSG 141 Query: 424 PPAVEVTSG*TG*RTYRCQYCYCIWFLFDQSSARAKTFLSTAQVVDDQV-FAIVSDEKVI 600 P + E+ S + + S + +F++ A+ + ++ FA SD K++ Sbjct: 142 PASAEIKSADDASEVVSDKKVVVVGIFPKLSGSEFDSFMAIAEKLRSELDFAHTSDAKLL 201 Score = 48.0 bits (109), Expect = 6e-06 Identities = 20/45 (44%), Positives = 31/45 (68%), Gaps = 3/45 (6%) Frame = +2 Query: 89 VPTEENV---LVLSKANFETVITTTEYILVEFYAPWCGHCKSLAP 214 +P E N +V+S + + V+ + + +L+EFYAPWCGHC+ LAP Sbjct: 368 IPAENNEPVKVVVSDSLDDIVLNSGKNVLLEFYAPWCGHCQKLAP 412 Score = 39.5 bits (88), Expect = 0.002 Identities = 18/53 (33%), Positives = 33/53 (62%), Gaps = 1/53 (1%) Frame = +1 Query: 259 IKLAKVDATQEQDLAESYGVRGYPTLKF-FRNGSXIDYSGGRQADDIISWLKK 414 + +AK+DAT +++ V+G+PT+ F +G+ + Y G R +D IS++ K Sbjct: 427 VVIAKLDATANDFPKDTFDVKGFPTIYFKSASGNVVVYEGDRTKEDFISFVDK 479 >At1g77510.1 68414.m09026 protein disulfide isomerase, putative similar to protein disulfide isomerase precursor GB:P29828 GI:4704766 [Medicago sativa]; Pfam HMM hit: PF00085 Thioredoxins Length = 508 Score = 71.3 bits (167), Expect = 6e-13 Identities = 33/68 (48%), Positives = 46/68 (67%), Gaps = 2/68 (2%) Frame = +2 Query: 47 FTAIALLGLALGD--EVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEY 220 F+ + LL L + T+E VL L +NF I+ ++I+VEFYAPWCGHC+ LAPEY Sbjct: 9 FSILLLLSLFVSSIRSEETKEFVLTLDHSNFTETISKHDFIVVEFYAPWCGHCQKLAPEY 68 Query: 221 AKAATKLA 244 KAA++L+ Sbjct: 69 EKAASELS 76 Score = 69.7 bits (163), Expect = 2e-12 Identities = 32/68 (47%), Positives = 51/68 (75%), Gaps = 4/68 (5%) Frame = +1 Query: 256 PIKLAKVDATQE--QDLAESYGVRGYPTLKFFRNG--SXIDYSGGRQADDIISWLKKKTG 423 P+ LAK+DA++E ++ A Y ++G+PTLK RNG S DY+G R+A+ I+++LKK++G Sbjct: 81 PLALAKIDASEEANKEFANEYKIQGFPTLKILRNGGKSVQDYNGPREAEGIVTYLKKQSG 140 Query: 424 PPAVEVTS 447 P +VE+ S Sbjct: 141 PASVEIKS 148 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/45 (42%), Positives = 31/45 (68%), Gaps = 3/45 (6%) Frame = +2 Query: 89 VPTEENV---LVLSKANFETVITTTEYILVEFYAPWCGHCKSLAP 214 +P E N +V++++ + V + + +L+EFYAPWCGHC+ LAP Sbjct: 366 IPAENNEPVKVVVAESLDDIVFKSGKNVLIEFYAPWCGHCQKLAP 410 Score = 39.9 bits (89), Expect = 0.002 Identities = 17/53 (32%), Positives = 35/53 (66%), Gaps = 1/53 (1%) Frame = +1 Query: 265 LAKVDATQEQDLAESYGVRGYPTLKF-FRNGSXIDYSGGRQADDIISWLKKKT 420 +AK+DAT ++++ V+G+PT+ F +G+ + Y G R +D I++++K + Sbjct: 427 IAKLDATANDIPSDTFDVKGFPTIYFRSASGNVVVYEGDRTKEDFINFVEKNS 479 >At2g47470.2 68415.m05924 thioredoxin family protein similar to protein disulfide isomerase [Dictyostelium discoideum] GI:2627440; contains Pfam profile: PF00085 Thioredoxin Length = 266 Score = 68.9 bits (161), Expect = 3e-12 Identities = 31/52 (59%), Positives = 38/52 (73%), Gaps = 1/52 (1%) Frame = +2 Query: 101 ENVLVLSKANF-ETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEE 253 +NV+VL+ NF E V+ + +LVEFYAPWCGHCKSLAP Y K AT +EE Sbjct: 141 QNVVVLTPDNFDEIVLDQNKDVLVEFYAPWCGHCKSLAPTYEKVATVFKQEE 192 Score = 61.7 bits (143), Expect = 5e-10 Identities = 31/61 (50%), Positives = 39/61 (63%) Frame = +2 Query: 44 IFTAIALLGLALGDEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYA 223 I+ ALL L L V ++V+VL+ +FE + + LVEFYAPWCGHCK LAPEY Sbjct: 6 IWFGFALLALLLVSAVA--DDVVVLTDDSFEKEVGKDKGALVEFYAPWCGHCKKLAPEYE 63 Query: 224 K 226 K Sbjct: 64 K 64 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/57 (45%), Positives = 37/57 (64%), Gaps = 2/57 (3%) Frame = +1 Query: 259 IKLAKVDATQEQDLAESYGVRGYPTLKFF--RNGSXIDYSGGRQADDIISWLKKKTG 423 + +A +DA + L E YGV G+PTLKFF N + DY GGR DD +S++ +K+G Sbjct: 194 VVIANLDADAHKALGEKYGVSGFPTLKFFPKDNKAGHDYDGGRDLDDFVSFINEKSG 250 Score = 44.8 bits (101), Expect = 6e-05 Identities = 20/57 (35%), Positives = 34/57 (59%), Gaps = 2/57 (3%) Frame = +1 Query: 259 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGS--XIDYSGGRQADDIISWLKKKTG 423 + +AKVD +++ + YGV GYPT+++F GS Y G R A+ + ++ K+ G Sbjct: 75 VLIAKVDCDEQKSVCTKYGVSGYPTIQWFPKGSLEPQKYEGPRNAEALAEYVNKEGG 131 >At2g47470.1 68415.m05925 thioredoxin family protein similar to protein disulfide isomerase [Dictyostelium discoideum] GI:2627440; contains Pfam profile: PF00085 Thioredoxin Length = 361 Score = 68.9 bits (161), Expect = 3e-12 Identities = 31/52 (59%), Positives = 38/52 (73%), Gaps = 1/52 (1%) Frame = +2 Query: 101 ENVLVLSKANF-ETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEE 253 +NV+VL+ NF E V+ + +LVEFYAPWCGHCKSLAP Y K AT +EE Sbjct: 141 QNVVVLTPDNFDEIVLDQNKDVLVEFYAPWCGHCKSLAPTYEKVATVFKQEE 192 Score = 61.7 bits (143), Expect = 5e-10 Identities = 31/61 (50%), Positives = 39/61 (63%) Frame = +2 Query: 44 IFTAIALLGLALGDEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYA 223 I+ ALL L L V ++V+VL+ +FE + + LVEFYAPWCGHCK LAPEY Sbjct: 6 IWFGFALLALLLVSAVA--DDVVVLTDDSFEKEVGKDKGALVEFYAPWCGHCKKLAPEYE 63 Query: 224 K 226 K Sbjct: 64 K 64 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/57 (45%), Positives = 37/57 (64%), Gaps = 2/57 (3%) Frame = +1 Query: 259 IKLAKVDATQEQDLAESYGVRGYPTLKFF--RNGSXIDYSGGRQADDIISWLKKKTG 423 + +A +DA + L E YGV G+PTLKFF N + DY GGR DD +S++ +K+G Sbjct: 194 VVIANLDADAHKALGEKYGVSGFPTLKFFPKDNKAGHDYDGGRDLDDFVSFINEKSG 250 Score = 44.8 bits (101), Expect = 6e-05 Identities = 20/57 (35%), Positives = 34/57 (59%), Gaps = 2/57 (3%) Frame = +1 Query: 259 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGS--XIDYSGGRQADDIISWLKKKTG 423 + +AKVD +++ + YGV GYPT+++F GS Y G R A+ + ++ K+ G Sbjct: 75 VLIAKVDCDEQKSVCTKYGVSGYPTIQWFPKGSLEPQKYEGPRNAEALAEYVNKEGG 131 >At3g54960.1 68416.m06094 thioredoxin family protein similar to protein disulfide isomerase GI:5902592 from [Volvox carteri f. nagariensis], GI:2708314 from Chlamydomonas reinhardtii; contains Pfam profile: PF00085 Thioredoxin Length = 579 Score = 64.5 bits (150), Expect = 6e-11 Identities = 36/116 (31%), Positives = 58/116 (50%), Gaps = 1/116 (0%) Frame = +1 Query: 265 LAKVDATQEQDLAESYGVRGYPTLKFFRNGS-XIDYSGGRQADDIISWLKKKTGPPAVEV 441 LAK+DAT+E DLA+ Y ++G+PT+ F +G Y G R D I++WLKKK P + Sbjct: 151 LAKIDATEEGDLAQKYEIQGFPTVFLFVDGEMRKTYEGERTKDGIVTWLKKKASPSIHNI 210 Query: 442 TSG*TG*RTYRCQYCYCIWFLFDQSSARAKTFLSTAQVVDDQVFAIVSDEKVIKEF 609 T+ R + FL + ++ + +++ DD F + + K F Sbjct: 211 TTKEEAERVLSAEPKLVFGFLNSLVGSESEELAAASRLEDDLSFYQTASPDIAKLF 266 Score = 63.7 bits (148), Expect = 1e-10 Identities = 26/48 (54%), Positives = 35/48 (72%) Frame = +2 Query: 98 EENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKL 241 E++V VL+K NF + + +VEFYAPWCG C++L PEYA AAT+L Sbjct: 98 EKDVAVLTKDNFTEFVGNNSFAMVEFYAPWCGACQALTPEYAAAATEL 145 Score = 47.2 bits (107), Expect = 1e-05 Identities = 27/72 (37%), Positives = 39/72 (54%), Gaps = 3/72 (4%) Frame = +2 Query: 20 DNIEMRVLIFTAIALLGLALGDEVP--TEENVLVLSKANF-ETVITTTEYILVEFYAPWC 190 +NI+ F A L D +P + +V V+ NF E V+ ++ +L+E YAPWC Sbjct: 408 NNIKTLAEDFLADKLKPFYKSDPLPENNDGDVKVIVGNNFDEIVLDESKDVLLEIYAPWC 467 Query: 191 GHCKSLAPEYAK 226 GHC+S P Y K Sbjct: 468 GHCQSFEPIYNK 479 >At1g52260.1 68414.m05897 thioredoxin family protein similar to protein disulfide isomerase GI:5902592 from [Volvox carteri f. nagariensis], GI:2708314 from Chlamydomonas reinhardtii; contains Pfam profile: PF00085 Thioredoxin Length = 537 Score = 63.3 bits (147), Expect = 1e-10 Identities = 34/116 (29%), Positives = 61/116 (52%), Gaps = 1/116 (0%) Frame = +1 Query: 259 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSXIDYSGGRQADDIISWLKKKTGPPAVE 438 + +AK+D + +A ++G+PTL F NG+ + Y+GG A+DI+ W++KKTG P + Sbjct: 130 VLMAKIDGDRYSKIASELEIKGFPTLLLFVNGTSLTYNGGSSAEDIVIWVQKKTGAPIIT 189 Query: 439 VTSG*TG*RTYRCQYCYCIWFLFDQ-SSARAKTFLSTAQVVDDQVFAIVSDEKVIK 603 + + R + +Y + LF++ + F+ A+ D+ F D V K Sbjct: 190 LNTVDEAPR-FLDKYHTFVLGLFEKFEGSEHNEFVKAAKSDDEIQFIETRDSDVAK 244 Score = 41.5 bits (93), Expect = 5e-04 Identities = 20/47 (42%), Positives = 27/47 (57%) Frame = +2 Query: 107 VLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAE 247 VL L+ + VI E+++V YAPWC L P +A+AAT L E Sbjct: 79 VLELNGDYTKRVIDGNEFVMVLGYAPWCARSAELMPRFAEAATALKE 125 >At1g35620.1 68414.m04425 thioredoxin family protein similar to SP|Q43116 Protein disulfide isomerase precursor (PDI) (EC 5.3.4.1) {Ricinus communis}; contains Pfam profile PF00085: Thioredoxin Length = 440 Score = 61.7 bits (143), Expect = 5e-10 Identities = 27/55 (49%), Positives = 37/55 (67%) Frame = +2 Query: 83 DEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAE 247 D+ + VL L+ +NF++ I+T + I V+FYAPWCGHCK L PE AA LA+ Sbjct: 26 DQFTLDGTVLELTDSNFDSAISTFDCIFVDFYAPWCGHCKRLNPELDAAAPILAK 80 Score = 45.2 bits (102), Expect = 4e-05 Identities = 21/64 (32%), Positives = 36/64 (56%) Frame = +1 Query: 256 PIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSXIDYSGGRQADDIISWLKKKTGPPAV 435 PI +AK++A + LA + +PTL + +G ++Y G R+AD ++ +LKK P Sbjct: 84 PIVIAKLNADKYSRLARKIEIDAFPTLMLYNHGVPMEYYGPRKADLLVRYLKKFVAPDVA 143 Query: 436 EVTS 447 + S Sbjct: 144 VLES 147 >At1g04980.1 68414.m00497 thioredoxin family protein similar to SP|Q63081 Protein disulfide isomerase A6 precursor (EC 5.3.4.1) {Rattus norvegicus}; contains Pfam profile PF00085: Thioredoxin Length = 443 Score = 58.4 bits (135), Expect = 4e-09 Identities = 23/43 (53%), Positives = 34/43 (79%), Gaps = 1/43 (2%) Frame = +2 Query: 116 LSKANFETVITTTEYI-LVEFYAPWCGHCKSLAPEYAKAATKL 241 L+ +NF+ ++T ++ + +VEF+APWCGHCK LAPE+ KAA L Sbjct: 168 LNSSNFDELVTESKELWIVEFFAPWCGHCKKLAPEWKKAANNL 210 Score = 54.8 bits (126), Expect = 5e-08 Identities = 23/46 (50%), Positives = 34/46 (73%), Gaps = 1/46 (2%) Frame = +2 Query: 107 VLVLSKANFET-VITTTEYILVEFYAPWCGHCKSLAPEYAKAATKL 241 VL L+ +NF++ V+ + +LVEF+APWCGHC+SL P + K A+ L Sbjct: 30 VLQLTPSNFKSKVLNSNGVVLVEFFAPWCGHCQSLTPTWEKVASTL 75 Score = 44.4 bits (100), Expect = 7e-05 Identities = 21/52 (40%), Positives = 31/52 (59%), Gaps = 1/52 (1%) Frame = +1 Query: 265 LAKVDATQEQDLAESYGVRGYPTLKFFRNGS-XIDYSGGRQADDIISWLKKK 417 +A +DA + +++ YGVRG+PT+K F G IDY G R A I + K+ Sbjct: 81 VAAIDADAHKSVSQDYGVRGFPTIKVFVPGKPPIDYQGARDAKSISQFAIKQ 132 Score = 35.9 bits (79), Expect = 0.026 Identities = 22/70 (31%), Positives = 34/70 (48%), Gaps = 6/70 (8%) Frame = +1 Query: 259 IKLAKVDATQEQDLAESYGVRGYPTLKFFRN--GSXIDYSGGRQADDIISW----LKKKT 420 +KL V+ EQ + + V+G+PT+ F + S + Y G R A I S+ L+ Sbjct: 214 VKLGHVNCDAEQSIKSRFKVQGFPTILVFGSDKSSPVPYEGARSASAIESFALEQLESNA 273 Query: 421 GPPAVEVTSG 450 GP V +G Sbjct: 274 GPAEVTELTG 283 >At2g32920.1 68415.m04036 thioredoxin family protein similar to SP|Q15084 Protein disulfide isomerase A6 precursor (EC 5.3.4.1) {Homo sapiens}; contains Pfam profile PF00085: Thioredoxin Length = 440 Score = 56.0 bits (129), Expect = 2e-08 Identities = 24/43 (55%), Positives = 32/43 (74%), Gaps = 1/43 (2%) Frame = +2 Query: 116 LSKANFET-VITTTEYILVEFYAPWCGHCKSLAPEYAKAATKL 241 L+ +NF+ VI + E +VEF+APWCGHCK LAPE+ +AA L Sbjct: 167 LNASNFDDLVIESNELWIVEFFAPWCGHCKKLAPEWKRAAKNL 209 Score = 52.8 bits (121), Expect = 2e-07 Identities = 22/46 (47%), Positives = 33/46 (71%), Gaps = 1/46 (2%) Frame = +2 Query: 107 VLVLSKANFET-VITTTEYILVEFYAPWCGHCKSLAPEYAKAATKL 241 V+ L+ +NF++ V+ + +LVEF+APWCGHCK+L P + K A L Sbjct: 32 VVQLTASNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTWEKVANIL 77 Score = 46.4 bits (105), Expect = 2e-05 Identities = 21/52 (40%), Positives = 32/52 (61%), Gaps = 1/52 (1%) Frame = +1 Query: 265 LAKVDATQEQDLAESYGVRGYPTLKFFRNG-SXIDYSGGRQADDIISWLKKK 417 +A +DA Q A+ YG++G+PT+K F G + IDY G R A I ++ K+ Sbjct: 83 VAAIDADAHQSAAQDYGIKGFPTIKVFVPGKAPIDYQGARDAKSIANFAYKQ 134 Score = 32.3 bits (70), Expect = 0.32 Identities = 21/66 (31%), Positives = 32/66 (48%), Gaps = 4/66 (6%) Frame = +1 Query: 259 IKLAKVDATQEQDLAESYGVRGYPTLKFF--RNGSXIDYSGGRQADDIISWLKK--KTGP 426 +KL V+ EQ + + V+G+PT+ F S Y G R A I S+ + ++ Sbjct: 213 VKLGHVNCDVEQSIMSRFKVQGFPTILVFGPDKSSPYPYEGARSASAIESFASELVESSA 272 Query: 427 PAVEVT 444 VEVT Sbjct: 273 GPVEVT 278 >At3g16110.1 68416.m02035 thioredoxin family protein similar to protein disulfide isomerase GI:5902592 from [Volvox carteri f. nagariensis], GI:2708314 from Chlamydomonas reinhardtii; contains Pfam profile: PF00085 Thioredoxin Length = 534 Score = 54.0 bits (124), Expect = 9e-08 Identities = 20/61 (32%), Positives = 39/61 (63%) Frame = +1 Query: 259 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSXIDYSGGRQADDIISWLKKKTGPPAVE 438 + +AK+D + +A ++G+PTL F NG+ Y+GG +++I+ W++KKTG ++ Sbjct: 128 VLMAKIDGERYSKVASQLEIKGFPTLLLFVNGTSQSYTGGFSSEEIVIWVQKKTGASTIK 187 Query: 439 V 441 + Sbjct: 188 L 188 Score = 44.0 bits (99), Expect = 1e-04 Identities = 20/47 (42%), Positives = 28/47 (59%) Frame = +2 Query: 107 VLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAE 247 V+ L+ N + +I EY++V YAPWC L P +A+AAT L E Sbjct: 77 VVELNGDNTKRLIDGNEYVMVLGYAPWCARSAELMPRFAEAATDLKE 123 >At4g27080.1 68417.m03893 thioredoxin family protein contains Pfam PF00085: Thioredoxin Length = 480 Score = 46.0 bits (104), Expect = 2e-05 Identities = 23/58 (39%), Positives = 32/58 (55%), Gaps = 2/58 (3%) Frame = +2 Query: 80 GDEVPTE--ENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAE 247 GDE E E+ + L+ NF+T ++V FYAPWC C L P + KAA ++ E Sbjct: 132 GDETGEEIVEDSVPLTGRNFDTFTHQFPILVVNFYAPWCYWCNLLKPSWEKAAKQIKE 189 Score = 41.1 bits (92), Expect = 7e-04 Identities = 17/33 (51%), Positives = 23/33 (69%) Frame = +1 Query: 265 LAKVDATQEQDLAESYGVRGYPTLKFFRNGSXI 363 LAKVD TQE DL ++GYP+++ FR GS + Sbjct: 201 LAKVDCTQEGDLCRRNHIQGYPSIRIFRKGSDL 233 >At2g01270.1 68415.m00040 thioredoxin family protein low similarity to quiescin [Homo sapiens] GI:13257405; contains Pfam profiles PF00085: Thioredoxin, PF04777: Erv1 / Alr family Length = 495 Score = 41.9 bits (94), Expect = 4e-04 Identities = 17/47 (36%), Positives = 29/47 (61%), Gaps = 2/47 (4%) Frame = +2 Query: 98 EENVLVLSKANFETVI--TTTEYILVEFYAPWCGHCKSLAPEYAKAA 232 ++ + L+ NF++V+ T +Y +VEF+A WC C++ P Y K A Sbjct: 34 KDKAVELNTTNFDSVLKDTPAKYAVVEFFAHWCPACRNYKPHYEKVA 80 >At1g69880.1 68414.m08042 thioredoxin, putative similar to SP|Q38879 Thioredoxin H-type 2 (TRX-H-2) {Arabidopsis thaliana}; contains Pfam profile: PF00085 Thioredoxin Length = 148 Score = 41.9 bits (94), Expect = 4e-04 Identities = 16/46 (34%), Positives = 27/46 (58%) Frame = +2 Query: 122 KANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEEFL 259 K+ + T + +++EF A WCG CK+L P+ + A K + EF+ Sbjct: 49 KSRLNALKDTNKLLVIEFTAKWCGPCKTLEPKLEELAAKYTDVEFV 94 >At1g15020.2 68414.m01795 thioredoxin family protein low similarity to FAD-dependent sulfhydryl oxidase-2 [Rattus norvegicus] GI:12483919; contains Pfam profiles PF00085: Thioredoxin, PF04777: Erv1 / Alr family Length = 528 Score = 41.1 bits (92), Expect = 7e-04 Identities = 16/47 (34%), Positives = 29/47 (61%), Gaps = 2/47 (4%) Frame = +2 Query: 98 EENVLVLSKANFETVI--TTTEYILVEFYAPWCGHCKSLAPEYAKAA 232 ++N + L+ NF++V + +Y ++EF+A WC C++ P Y K A Sbjct: 40 KDNAIELNATNFDSVFQDSPAKYAVLEFFAHWCPACRNYKPHYEKVA 86 >At1g15020.1 68414.m01794 thioredoxin family protein low similarity to FAD-dependent sulfhydryl oxidase-2 [Rattus norvegicus] GI:12483919; contains Pfam profiles PF00085: Thioredoxin, PF04777: Erv1 / Alr family Length = 502 Score = 41.1 bits (92), Expect = 7e-04 Identities = 16/47 (34%), Positives = 29/47 (61%), Gaps = 2/47 (4%) Frame = +2 Query: 98 EENVLVLSKANFETVI--TTTEYILVEFYAPWCGHCKSLAPEYAKAA 232 ++N + L+ NF++V + +Y ++EF+A WC C++ P Y K A Sbjct: 40 KDNAIELNATNFDSVFQDSPAKYAVLEFFAHWCPACRNYKPHYEKVA 86 >At1g62180.1 68414.m07014 5'-adenylylsulfate reductase 2, chloroplast (APR2) (APSR) / adenosine 5'-phosphosulfate 5'-adenylylsulfate (APS) sulfotransferase 2 / 3'-phosphoadenosine-5'-phosphosulfate (PAPS) reductase homolog 43 (PRH-43) identical to SP|P92981 5'-adenylylsulfate reductase 2, chloroplast precursor (EC 1.8.4.9) (Adenosine 5'-phosphosulfate 5'-adenylylsulfate sulfotransferase 2) (APS sulfotransferase 2) (Thioredoxin independent APS reductase 2) (3'-phosphoadenosine-5'-phosphosulfate reductase homolog 43) (PAPS reductase homolog 43) (Prh-43) {Arabidopsis thaliana}; identical to cDNA PAPS reductase homolog (PRH43) GI:1710115 Length = 454 Score = 40.7 bits (91), Expect = 0.001 Identities = 21/56 (37%), Positives = 29/56 (51%), Gaps = 3/56 (5%) Frame = +2 Query: 86 EVPTEENVLVLSKANFETVI---TTTEYILVEFYAPWCGHCKSLAPEYAKAATKLA 244 E+ NV+ LSK E ++ E LV YAPWC C+++ Y + A KLA Sbjct: 337 EIFESNNVVALSKGGVENLLKLENRKEAWLVVLYAPWCPFCQAMEASYIELAEKLA 392 >At4g37200.1 68417.m05266 thioredoxin family protein contains Pfam profile: PF00085 Thioredoxin; identical to cDNA thioredoxin-like protein (hcf164 gene) GI;12049652 Length = 261 Score = 39.9 bits (89), Expect = 0.002 Identities = 23/70 (32%), Positives = 35/70 (50%), Gaps = 2/70 (2%) Frame = +2 Query: 23 NIEMRVLIFTAIALLGLALGDEVPTEENV--LVLSKANFETVITTTEYILVEFYAPWCGH 196 +I RV T IA L L + + ++ L S +E ++ + +VEFYA WC Sbjct: 93 DINRRVAAVTVIAALSLFVSTRLDFGISLKDLTASALPYEEALSNGKPTVVEFYADWCEV 152 Query: 197 CKSLAPEYAK 226 C+ LAP+ K Sbjct: 153 CRELAPDVYK 162 >At2g33270.1 68415.m04078 thioredoxin family protein contains Pfam profile: PF00085 Thioredoxin Length = 273 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/33 (48%), Positives = 23/33 (69%) Frame = +2 Query: 161 ILVEFYAPWCGHCKSLAPEYAKAATKLAEEEFL 259 ++V+F++P CG CK+L P+ K A K E EFL Sbjct: 116 VVVDFFSPSCGGCKALHPKICKIAEKNPEVEFL 148 >At1g59730.1 68414.m06725 thioredoxin, putative similar to SP|Q38879 Thioredoxin H-type 2 (TRX-H-2) {Arabidopsis thaliana}; contains Pfam profile: PF00085 Thioredoxin Length = 129 Score = 38.7 bits (86), Expect = 0.004 Identities = 14/45 (31%), Positives = 29/45 (64%) Frame = +2 Query: 122 KANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEEF 256 K+ F+++ + + ++++F A WCG CK++ P + A+K +E F Sbjct: 33 KSLFDSMKGSNKLLVIDFTAVWCGPCKAMEPRVREIASKYSEAVF 77 >At1g03680.1 68414.m00347 thioredoxin M-type 1, chloroplast (TRX-M1) nearly identical to SP|O48737 Thioredoxin M-type 1, chloroplast precursor (TRX-M1) {Arabidopsis thaliana}; similar to ESTs gb|T13714, gb|H76398, gb|N37762, gb|AA042639, gb|T21104, emb|Z30901 Length = 179 Score = 38.3 bits (85), Expect = 0.005 Identities = 17/51 (33%), Positives = 30/51 (58%), Gaps = 1/51 (1%) Frame = +2 Query: 95 TEENVLVLSKANFET-VITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLA 244 T + V++ + +++ V+ E + V+F+APWCG CK + P + A K A Sbjct: 72 TATGIPVVNDSTWDSLVLKADEPVFVDFWAPWCGPCKMIDPIVNELAQKYA 122 Score = 27.5 bits (58), Expect = 9.0 Identities = 14/47 (29%), Positives = 21/47 (44%) Frame = +1 Query: 262 KLAKVDATQEQDLAESYGVRGYPTLKFFRNGSXIDYSGGRQADDIIS 402 K K++ + YGVR PT+ F NG D G + D ++ Sbjct: 126 KFYKLNTDESPATPGQYGVRSIPTIMIFVNGEKKDTIIGAVSKDTLA 172 >At1g19730.1 68414.m02465 thioredoxin H-type 4 (TRX-H-4) (GREN) identical to SP|Q39239 Thioredoxin H-type 4 (TRX-H-4) {Arabidopsis thaliana} Length = 119 Score = 37.5 bits (83), Expect = 0.008 Identities = 17/51 (33%), Positives = 27/51 (52%) Frame = +1 Query: 271 KVDATQEQDLAESYGVRGYPTLKFFRNGSXIDYSGGRQADDIISWLKKKTG 423 KVD + Q +A+ +GV PT F + G +D G +D+ + + K TG Sbjct: 65 KVDVDELQSVAKEFGVEAMPTFVFIKAGEVVDKLVGANKEDLQAKIVKHTG 115 Score = 28.7 bits (61), Expect = 3.9 Identities = 10/30 (33%), Positives = 18/30 (60%) Frame = +2 Query: 149 TTEYILVEFYAPWCGHCKSLAPEYAKAATK 238 + + I+++F A WC C+ +AP + A K Sbjct: 27 SNKLIVIDFTASWCPPCRMIAPIFNDLAKK 56 >At4g04610.1 68417.m00674 5'-adenylylsulfate reductase (APR1) / PAPS reductase homolog (PRH19) identical to 5'-adenylylsulfate reductase [Arabidopsis thaliana] GI:2738756; identical to cDNA PAPS reductase homolog (PRH19) GI:1710111 Length = 465 Score = 37.1 bits (82), Expect = 0.011 Identities = 18/51 (35%), Positives = 28/51 (54%), Gaps = 3/51 (5%) Frame = +2 Query: 101 ENVLVLSKANFETVI---TTTEYILVEFYAPWCGHCKSLAPEYAKAATKLA 244 EN++ LS+ E ++ E +V YAPWC C+++ Y + A KLA Sbjct: 353 ENLVTLSRQGIENLMKLENRKEPWIVVLYAPWCPFCQAMEASYDELADKLA 403 >At4g03520.1 68417.m00480 thioredoxin M-type 2, chloroplast (TRX-M2) nearly identical to SP|Q9SEU8 Thioredoxin M-type 2, chloroplast precursor (TRX-M2) {Arabidopsis thaliana} Length = 186 Score = 37.1 bits (82), Expect = 0.011 Identities = 14/41 (34%), Positives = 28/41 (68%), Gaps = 1/41 (2%) Frame = +2 Query: 95 TEENVLVLSKANFET-VITTTEYILVEFYAPWCGHCKSLAP 214 T ++ V++ + +++ V+ T ++V+F+APWCG CK + P Sbjct: 78 TTTDIQVVNDSTWDSLVLKATGPVVVDFWAPWCGPCKMIDP 118 >At3g15360.1 68416.m01948 thioredoxin M-type 4, chloroplast (TRX-M4) nearly identical to SP|Q9SEU6 Thioredoxin M-type 4, chloroplast precursor (TRX-M4) {Arabidopsis thaliana} Length = 193 Score = 37.1 bits (82), Expect = 0.011 Identities = 14/34 (41%), Positives = 24/34 (70%), Gaps = 1/34 (2%) Frame = +2 Query: 116 LSKANFETVITTTEY-ILVEFYAPWCGHCKSLAP 214 LS + ++T + ++ +LVEF+APWCG C+ + P Sbjct: 91 LSDSEWQTKVLESDVPVLVEFWAPWCGPCRMIHP 124 Score = 28.7 bits (61), Expect = 3.9 Identities = 11/35 (31%), Positives = 18/35 (51%) Frame = +1 Query: 262 KLAKVDATQEQDLAESYGVRGYPTLKFFRNGSXID 366 K K++ + + A YG+R PT+ F+ G D Sbjct: 138 KFYKINTDESPNTANRYGIRSVPTVIIFKGGEKKD 172 >At1g50950.1 68414.m05728 thioredoxin-related contains weak hit to Pfam PF00085: Thioredoxin; contains 2 predicted transmembrane domains Length = 484 Score = 37.1 bits (82), Expect = 0.011 Identities = 19/66 (28%), Positives = 33/66 (50%), Gaps = 10/66 (15%) Frame = +1 Query: 259 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSXI----------DYSGGRQADDIISWL 408 + L VD T+E L +S ++GYP+++ FR GS + Y G R D ++ + Sbjct: 200 VLLGSVDCTEEPTLCKSNHIQGYPSIRIFRRGSGLREDHGNHEHESYYGDRDTDSLVKMV 259 Query: 409 KKKTGP 426 ++ P Sbjct: 260 EELLKP 265 Score = 33.9 bits (74), Expect = 0.10 Identities = 15/39 (38%), Positives = 21/39 (53%) Frame = +2 Query: 116 LSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAA 232 L+ A FE + ++V FYAPWC L P + KA+ Sbjct: 147 LTGAAFEKFTHHFQILVVNFYAPWCYWSNRLKPSWVKAS 185 >At3g51030.1 68416.m05587 thioredoxin H-type 1 (TRX-H-1) identical to SP|P29448 Thioredoxin H-type 1 (TRX-H-1) {Arabidopsis thaliana} Length = 114 Score = 36.7 bits (81), Expect = 0.015 Identities = 15/33 (45%), Positives = 21/33 (63%) Frame = +2 Query: 161 ILVEFYAPWCGHCKSLAPEYAKAATKLAEEEFL 259 ++V+F A WCG C+ +AP +A A KL FL Sbjct: 31 VVVDFTASWCGPCRFIAPFFADLAKKLPNVLFL 63 Score = 32.7 bits (71), Expect = 0.24 Identities = 14/57 (24%), Positives = 30/57 (52%), Gaps = 1/57 (1%) Frame = +1 Query: 247 RRIP-IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSXIDYSGGRQADDIISWLKK 414 +++P + KVD + + +A + ++ PT F + G +D G + D++ S + K Sbjct: 55 KKLPNVLFLKVDTDELKSVASDWAIQAMPTFMFLKEGKILDKVVGAKKDELQSTIAK 111 >At3g20560.1 68416.m02603 thioredoxin family protein contains Pfam profile PF00085: Thioredoxin Length = 483 Score = 36.7 bits (81), Expect = 0.015 Identities = 20/63 (31%), Positives = 32/63 (50%), Gaps = 2/63 (3%) Frame = +2 Query: 50 TAIALLGLALGDEVPTE--ENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYA 223 + +AL + G+E E + + L+ A+FE + ++V F APWC L P + Sbjct: 122 SGLALHNINHGEETKEEFPDGAIPLTSASFEALSHHFPILVVNFNAPWCYWSNRLKPSWE 181 Query: 224 KAA 232 KAA Sbjct: 182 KAA 184 Score = 35.5 bits (78), Expect = 0.034 Identities = 19/66 (28%), Positives = 31/66 (46%), Gaps = 10/66 (15%) Frame = +1 Query: 259 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSXI----------DYSGGRQADDIISWL 408 + L VD T+E L + ++GYP+++ FR GS + Y G R D I+ + Sbjct: 199 VLLGNVDCTEEPALCKRNHIQGYPSIRIFRKGSDLREDHGHHEHESYYGDRDTDSIVKMV 258 Query: 409 KKKTGP 426 + P Sbjct: 259 EGLVAP 264 >At5g16400.1 68418.m01917 thioredoxin, putative similar to SP|P29450 Thioredoxin F-type, chloroplast precursor (TRX-F) {Pisum sativum}; contains Pfam profile: PF00085 Thioredoxin Length = 185 Score = 36.3 bits (80), Expect = 0.020 Identities = 12/33 (36%), Positives = 21/33 (63%) Frame = +2 Query: 161 ILVEFYAPWCGHCKSLAPEYAKAATKLAEEEFL 259 ++++ Y WCG CK +AP+Y + + K + FL Sbjct: 100 VVLDMYTQWCGPCKVIAPKYKELSEKYQDMVFL 132 Score = 27.5 bits (58), Expect = 9.0 Identities = 12/45 (26%), Positives = 25/45 (55%), Gaps = 1/45 (2%) Frame = +1 Query: 271 KVDATQE-QDLAESYGVRGYPTLKFFRNGSXIDYSGGRQADDIIS 402 K+D Q+ + LA+ G+R PT K ++ + G + +D+++ Sbjct: 133 KLDCNQDNKPLAKELGIRVVPTFKILKDNKVVKEVTGAKYEDLLA 177 >At5g61440.1 68418.m07709 thioredoxin family protein low similarity to thioredoxin [Callithrix jacchus] GI:13560979; contains Pfam profile: PF00085 Thioredoxin Length = 245 Score = 35.9 bits (79), Expect = 0.026 Identities = 18/52 (34%), Positives = 31/52 (59%), Gaps = 3/52 (5%) Frame = +2 Query: 86 EVPTEENVLVLSKANF--ETVITTTEYILV-EFYAPWCGHCKSLAPEYAKAA 232 E T N+L + AN ++++ + ++V +FY+P CG CKSL P+ + A Sbjct: 80 EKSTNHNMLEIQSANHLVDSLLNAGDRLVVLDFYSPGCGGCKSLHPKICQLA 131 >At4g29670.2 68417.m04227 thioredoxin family protein contains Pfam profile PF00085: Thioredoxin Length = 236 Score = 35.9 bits (79), Expect = 0.026 Identities = 13/33 (39%), Positives = 20/33 (60%) Frame = +2 Query: 161 ILVEFYAPWCGHCKSLAPEYAKAATKLAEEEFL 259 ++VEFY WC C++L P+ K A + + FL Sbjct: 126 VIVEFYGTWCASCRALFPKLCKTAVEHPDIVFL 158 >At4g29670.1 68417.m04226 thioredoxin family protein contains Pfam profile PF00085: Thioredoxin Length = 235 Score = 35.9 bits (79), Expect = 0.026 Identities = 13/33 (39%), Positives = 20/33 (60%) Frame = +2 Query: 161 ILVEFYAPWCGHCKSLAPEYAKAATKLAEEEFL 259 ++VEFY WC C++L P+ K A + + FL Sbjct: 126 VIVEFYGTWCASCRALFPKLCKTAVEHPDIVFL 158 >At4g21990.1 68417.m03183 5'-adenylylsulfate reductase (APR3) / PAPS reductase homolog (PRH26) identical to 5'-adenylylsulfate reductase [Arabidopsis thaliana] GI:2738760; identical to cDNA PAPS reductase homolog (PRH26) GI:1710113 Length = 458 Score = 35.5 bits (78), Expect = 0.034 Identities = 19/61 (31%), Positives = 31/61 (50%), Gaps = 3/61 (4%) Frame = +2 Query: 68 GLALGDEVPTEENVLVLSKANFETVI---TTTEYILVEFYAPWCGHCKSLAPEYAKAATK 238 G A ++ ENV+ LS+ E ++ E +V YAPWC C+++ + + A K Sbjct: 335 GTASVADIFNSENVVNLSRQGIENLMKLENRKEAWIVVLYAPWCPFCQAMEASFDELADK 394 Query: 239 L 241 L Sbjct: 395 L 395 >At3g02730.1 68416.m00265 thioredoxin, putative similar to SP|P29450 Thioredoxin F-type, chloroplast precursor (TRX-F) {Pisum sativum}; contains Pfam profile: PF00085 Thioredoxin Length = 178 Score = 35.1 bits (77), Expect = 0.045 Identities = 12/33 (36%), Positives = 20/33 (60%) Frame = +2 Query: 161 ILVEFYAPWCGHCKSLAPEYAKAATKLAEEEFL 259 ++++ Y WCG CK +AP+Y + K + FL Sbjct: 90 VVLDMYTQWCGPCKVIAPKYKALSEKYDDVVFL 122 >At1g50320.1 68414.m05641 thioredoxin x nearly identical to thioredoxin x GB:AAF15952 GI:6539616 from [Arabidopsis thaliana] Length = 182 Score = 35.1 bits (77), Expect = 0.045 Identities = 13/26 (50%), Positives = 18/26 (69%) Frame = +2 Query: 137 TVITTTEYILVEFYAPWCGHCKSLAP 214 TV+ + + +LVEF A WCG CK + P Sbjct: 82 TVLESAQPVLVEFVATWCGPCKLIYP 107 >At4g26160.1 68417.m03765 thioredoxin family protein low similarity to thioredoxin [Ictalurus punctatus] GI:9837585; contains Pfam profile: PF00085 Thioredoxin Length = 221 Score = 34.7 bits (76), Expect = 0.060 Identities = 10/24 (41%), Positives = 17/24 (70%) Frame = +2 Query: 161 ILVEFYAPWCGHCKSLAPEYAKAA 232 ++V+FY WCG C+++ P+ K A Sbjct: 116 VIVDFYGTWCGSCRAMFPKLCKTA 139 >At1g34780.1 68414.m04329 protein disulfide isomerase-related contains weak similarity to Pfam:P08003 protein disulfide isomerase A4 precursor (Protein ERp-72, ERp72) [Mus musculus] Length = 310 Score = 33.9 bits (74), Expect = 0.10 Identities = 15/46 (32%), Positives = 23/46 (50%) Frame = +1 Query: 310 YGVRGYPTLKFFRNGSXIDYSGGRQADDIISWLKKKTGPPAVEVTS 447 YGV G+PTL + Y G R D ++++ TG ++ TS Sbjct: 131 YGVHGFPTLLLLNSTMRARYRGTRMLDSLVAFYSDVTGIETLDKTS 176 >At5g39950.1 68418.m04844 thioredoxin H-type 2 (TRX-H-2) (Gif2) identical to SP|Q38879 Thioredoxin H-type 2 (TRX-H-2) {Arabidopsis thaliana}; identical to cDNA (Gif2) mRNA for thioredoxin GI:992963 Length = 133 Score = 33.5 bits (73), Expect = 0.14 Identities = 12/44 (27%), Positives = 24/44 (54%) Frame = +2 Query: 128 NFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEEFL 259 +F + + + ++V+F A WCG C+ + P A K + +F+ Sbjct: 39 HFNEIKESNKLLVVDFSASWCGPCRMIEPAIHAMADKFNDVDFV 82 >At1g45145.1 68414.m05175 thioredoxin H-type 5 (TRX-H-5) (TOUL) identical to SP|Q39241 Thioredoxin H-type 5 (TRX-H-5) {Arabidopsis thaliana}; identical to cDNA (TOUL) mRNA for thioredoxin GI:992965 Length = 118 Score = 33.5 bits (73), Expect = 0.14 Identities = 17/51 (33%), Positives = 25/51 (49%) Frame = +1 Query: 271 KVDATQEQDLAESYGVRGYPTLKFFRNGSXIDYSGGRQADDIISWLKKKTG 423 K+D + Q +A+ + V PT F + G+ ID G D+I L K G Sbjct: 63 KIDVDELQAVAQEFKVEAMPTFVFMKEGNIIDRVVGAAKDEINEKLMKHGG 113 Score = 32.3 bits (70), Expect = 0.32 Identities = 12/32 (37%), Positives = 19/32 (59%) Frame = +2 Query: 161 ILVEFYAPWCGHCKSLAPEYAKAATKLAEEEF 256 I+++F A WC C+ +AP +A+ A K F Sbjct: 30 IVIDFTASWCPPCRFIAPVFAEMAKKFTNVVF 61 >At3g17880.1 68416.m02278 tetratricoredoxin (TDX) identical to tetratricoredoxin [Arabidopsis thaliana] GI:18041544; similar to SP|Q42443 Thioredoxin H-type (TRX-H) (Phloem sap 13 kDa protein-1) {Oryza sativa}; contains Pfam profile: PF00085 Thioredoxin Length = 380 Score = 32.7 bits (71), Expect = 0.24 Identities = 12/33 (36%), Positives = 21/33 (63%) Frame = +2 Query: 161 ILVEFYAPWCGHCKSLAPEYAKAATKLAEEEFL 259 +++ F A WCG C+ ++P Y+ AT+ + FL Sbjct: 295 LILYFTATWCGPCRYMSPLYSNLATQHSRVVFL 327 Score = 30.3 bits (65), Expect = 1.3 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = +1 Query: 271 KVDATQEQDLAESYGVRGYPTLKFFRNGSXID 366 KVD + D+A S+ + PT F R+G +D Sbjct: 328 KVDIDKANDVAASWNISSVPTFCFIRDGKEVD 359 >At1g76760.1 68414.m08933 thioredoxin family protein similar to thioredoxin CH2, M-type, chloroplast precursor GB:P23400 SP|P23400 [Chlamydomonas reinhardtii]; contains Pfam profile: PF00085 Thioredoxin Length = 172 Score = 32.7 bits (71), Expect = 0.24 Identities = 11/30 (36%), Positives = 21/30 (70%), Gaps = 1/30 (3%) Frame = +2 Query: 128 NFETVITTTEY-ILVEFYAPWCGHCKSLAP 214 +FE ++ ++ +LV++YA WCG C+ + P Sbjct: 72 SFEDLLVNSDKPVLVDYYATWCGPCQFMVP 101 Score = 29.1 bits (62), Expect = 3.0 Identities = 13/48 (27%), Positives = 23/48 (47%), Gaps = 1/48 (2%) Frame = +1 Query: 259 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSXID-YSGGRQADDII 399 I++ K+D + +A Y + PT F++G D + G A +I Sbjct: 114 IQVVKIDTEKYPSIANKYKIEALPTFILFKDGEPCDRFEGALTAKQLI 161 >At1g08570.1 68414.m00950 thioredoxin family protein contains Pfam profile: PF00085 Thioredoxin; similar to ESTs gb|T46281, gb|R83933, gb|N65879, emb|F14466, gb|N96726, gb|AA042340, and emb|Z18150 Length = 275 Score = 32.7 bits (71), Expect = 0.24 Identities = 12/33 (36%), Positives = 22/33 (66%) Frame = +2 Query: 161 ILVEFYAPWCGHCKSLAPEYAKAATKLAEEEFL 259 ++V+F++P CG CK+L P+ + A + +FL Sbjct: 120 VVVDFFSPGCGGCKALHPKICQFAEMNPDVQFL 152 >At1g43560.1 68414.m05000 thioredoxin family protein contains Pfam profile: PF00085 Thioredoxin; similar to thioredoxin GI:142153 from [Synechococcus PCC6301] Length = 167 Score = 32.3 bits (70), Expect = 0.32 Identities = 10/18 (55%), Positives = 14/18 (77%) Frame = +2 Query: 161 ILVEFYAPWCGHCKSLAP 214 +LV+FYA WCG C+ + P Sbjct: 79 VLVDFYATWCGPCQLMVP 96 Score = 28.7 bits (61), Expect = 3.9 Identities = 13/48 (27%), Positives = 23/48 (47%), Gaps = 1/48 (2%) Frame = +1 Query: 259 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSXID-YSGGRQADDII 399 I + K+D + LA Y + PT F++G D + G A+ ++ Sbjct: 109 IAVVKIDTEKYPSLANKYQIEALPTFILFKDGKLWDRFEGALPANQLV 156 >At4g04950.1 68417.m00719 thioredoxin family protein similar to PKCq-interacting protein PICOT from [Mus musculus] GI:6840949, [Rattus norvegicus] GI:6840951; contains Pfam profile PF00085: Thioredoxin Length = 488 Score = 31.9 bits (69), Expect = 0.42 Identities = 13/51 (25%), Positives = 26/51 (50%) Frame = +1 Query: 271 KVDATQEQDLAESYGVRGYPTLKFFRNGSXIDYSGGRQADDIISWLKKKTG 423 +V+A + +++E+Y V P FF++G +D G + + + K G Sbjct: 57 RVEAEEHPEISEAYSVAAVPYFVFFKDGKTVDTLEGADPSSLANKVGKVAG 107 Score = 27.9 bits (59), Expect = 6.8 Identities = 11/48 (22%), Positives = 23/48 (47%) Frame = +2 Query: 113 VLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEEF 256 ++SKA + + + +++ F+A WC K + ++ AT F Sbjct: 8 IVSKAELDNLRQSGAPVVLHFWASWCDASKQMDQVFSHLATDFPRAHF 55 >At4g08930.1 68417.m01470 thioredoxin-related contains weak similarity to Swiss-Prot:Q39239 thioredoxin H-type 4 (TRX-H-4). [Mouse-ear cress] Length = 295 Score = 31.5 bits (68), Expect = 0.56 Identities = 12/38 (31%), Positives = 20/38 (52%) Frame = +1 Query: 310 YGVRGYPTLKFFRNGSXIDYSGGRQADDIISWLKKKTG 423 YGV G+PT+ + + Y G R D ++++ TG Sbjct: 124 YGVHGFPTIILMNSTMLVVYRGSRTLDSLVAFYTDVTG 161 >At3g19780.1 68416.m02504 expressed protein Length = 1014 Score = 31.5 bits (68), Expect = 0.56 Identities = 15/48 (31%), Positives = 25/48 (52%) Frame = +2 Query: 113 VLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEEF 256 +L++ NF + I ++L+ PWCG +SL E + + EEF Sbjct: 29 ILTEQNFSSQIRLHPHVLLFVTTPWCGESRSLKYEITQMVQR--REEF 74 >At2g15570.1 68415.m01783 thioredoxin M-type 3, chloroplast (TRX-M3) identical to SP|Q9SEU7 Thioredoxin M-type 3, chloroplast precursor (TRX-M3) {Arabidopsis thaliana} Length = 173 Score = 31.1 bits (67), Expect = 0.73 Identities = 10/23 (43%), Positives = 16/23 (69%) Frame = +2 Query: 134 ETVITTTEYILVEFYAPWCGHCK 202 ++V+ + +LVEFY WCG C+ Sbjct: 78 DSVLKSETPVLVEFYTSWCGPCR 100 >At5g42980.1 68418.m05242 thioredoxin H-type 3 (TRX-H-3) (GIF1) identical to SP|Q42403 Thioredoxin H-type 3 (TRX-H-3) {Arabidopsis thaliana}; identical to cDNA (GIF1) mRNA for thioredoxin GI:992961 Length = 118 Score = 30.7 bits (66), Expect = 0.97 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = +2 Query: 161 ILVEFYAPWCGHCKSLAPEYAKAATK 238 I+++F A WC C+ +AP +A A K Sbjct: 30 IVIDFTATWCPPCRFIAPVFADLAKK 55 Score = 30.3 bits (65), Expect = 1.3 Identities = 15/56 (26%), Positives = 28/56 (50%) Frame = +1 Query: 247 RRIPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSXIDYSGGRQADDIISWLKK 414 + + + KVD + +AE + V+ PT F + G + G ++II+ L+K Sbjct: 55 KHLDVVFFKVDVDELNTVAEEFKVQAMPTFIFMKEGEIKETVVGAAKEEIIANLEK 110 >At3g08710.1 68416.m01012 thioredoxin family protein similar to thioredoxin H-type GB:P29448 SP|P29448 [Arabidopsis thaliana], Thioredoxin H-type 2 (TRX-H2) SP|Q07090 {Nicotiana tabacum}; contains Pfam profile: PF00085 Thioredoxin Length = 140 Score = 30.7 bits (66), Expect = 0.97 Identities = 12/33 (36%), Positives = 19/33 (57%) Frame = +2 Query: 161 ILVEFYAPWCGHCKSLAPEYAKAATKLAEEEFL 259 ++ F A WCG CK +AP + + + K + FL Sbjct: 48 VVANFSATWCGPCKIVAPFFIELSEKHSSLMFL 80 >At4g32580.1 68417.m04638 thioredoxin family protein contains Pfam profile: PF00085 Thioredoxin Length = 160 Score = 30.3 bits (65), Expect = 1.3 Identities = 13/51 (25%), Positives = 26/51 (50%) Frame = +1 Query: 271 KVDATQEQDLAESYGVRGYPTLKFFRNGSXIDYSGGRQADDIISWLKKKTG 423 +V+A + +++E+Y V P FF++G +D G + + + K G Sbjct: 57 RVEAEEHPEISEAYSVALVPYFVFFKDGKTVDTLEGADPSSLANKVGKVAG 107 >At3g06730.1 68416.m00798 thioredoxin family protein contains Pfam profile: PF00085 Thioredoxin Length = 183 Score = 30.3 bits (65), Expect = 1.3 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = +2 Query: 161 ILVEFYAPWCGHCKSLAPEYAKAATK 238 ++V+FYA WCG C +A E A + Sbjct: 97 LIVDFYATWCGPCILMAQELEMLAVE 122 >At1g52990.1 68414.m05997 thioredoxin family protein similar to SP|P48384 Thioredoxin M-type, chloroplast precursor (TRX-M) {Pisum sativum}; contains Pfam profile PF00085: Thioredoxin Length = 313 Score = 29.5 bits (63), Expect = 2.2 Identities = 11/33 (33%), Positives = 18/33 (54%) Frame = +2 Query: 152 TEYILVEFYAPWCGHCKSLAPEYAKAATKLAEE 250 T +++V F A WCG C+ + P K ++ E Sbjct: 227 TPHVMVMFTARWCGPCRDMIPILNKMDSEYKNE 259 >At1g07960.3 68414.m00867 thioredoxin family protein low similarity to protein disulfide isomerase 4 [Giardia intestinalis] GI:13489047; contains Pfam profile PF00085: Thioredoxin Length = 146 Score = 29.5 bits (63), Expect = 2.2 Identities = 13/55 (23%), Positives = 27/55 (49%), Gaps = 1/55 (1%) Frame = +1 Query: 259 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSXID-YSGGRQADDIISWLKKKT 420 I++ +VD + + + YPT F NG + Y G R + + +++ ++T Sbjct: 78 IEVGEVDCGTSRAVCTKVEIHSYPTFMLFYNGEEVSKYKGKRDVESLKAFVVEET 132 Score = 28.7 bits (61), Expect = 3.9 Identities = 13/35 (37%), Positives = 17/35 (48%), Gaps = 1/35 (2%) Frame = +2 Query: 107 VLVLSKANFETVITTTEYI-LVEFYAPWCGHCKSL 208 V+ L+ F I + V+F PWC HCK L Sbjct: 27 VITLTPETFSDKIKEKDTAWFVKFCVPWCKHCKKL 61 >At1g07960.2 68414.m00866 thioredoxin family protein low similarity to protein disulfide isomerase 4 [Giardia intestinalis] GI:13489047; contains Pfam profile PF00085: Thioredoxin Length = 146 Score = 29.5 bits (63), Expect = 2.2 Identities = 13/55 (23%), Positives = 27/55 (49%), Gaps = 1/55 (1%) Frame = +1 Query: 259 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSXID-YSGGRQADDIISWLKKKT 420 I++ +VD + + + YPT F NG + Y G R + + +++ ++T Sbjct: 78 IEVGEVDCGTSRAVCTKVEIHSYPTFMLFYNGEEVSKYKGKRDVESLKAFVVEET 132 Score = 28.7 bits (61), Expect = 3.9 Identities = 13/35 (37%), Positives = 17/35 (48%), Gaps = 1/35 (2%) Frame = +2 Query: 107 VLVLSKANFETVITTTEYI-LVEFYAPWCGHCKSL 208 V+ L+ F I + V+F PWC HCK L Sbjct: 27 VITLTPETFSDKIKEKDTAWFVKFCVPWCKHCKKL 61 >At1g07960.1 68414.m00865 thioredoxin family protein low similarity to protein disulfide isomerase 4 [Giardia intestinalis] GI:13489047; contains Pfam profile PF00085: Thioredoxin Length = 146 Score = 29.5 bits (63), Expect = 2.2 Identities = 13/55 (23%), Positives = 27/55 (49%), Gaps = 1/55 (1%) Frame = +1 Query: 259 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSXID-YSGGRQADDIISWLKKKT 420 I++ +VD + + + YPT F NG + Y G R + + +++ ++T Sbjct: 78 IEVGEVDCGTSRAVCTKVEIHSYPTFMLFYNGEEVSKYKGKRDVESLKAFVVEET 132 Score = 28.7 bits (61), Expect = 3.9 Identities = 13/35 (37%), Positives = 17/35 (48%), Gaps = 1/35 (2%) Frame = +2 Query: 107 VLVLSKANFETVITTTEYI-LVEFYAPWCGHCKSL 208 V+ L+ F I + V+F PWC HCK L Sbjct: 27 VITLTPETFSDKIKEKDTAWFVKFCVPWCKHCKKL 61 >At3g63440.1 68416.m07143 FAD-binding domain-containing protein / cytokinin oxidase family protein similar to cytokinin oxidase, Zea mays, EMBL:ZMY18377 [gi:3882018] [gi:3441978] Length = 504 Score = 29.1 bits (62), Expect = 3.0 Identities = 17/54 (31%), Positives = 27/54 (50%) Frame = -3 Query: 297 ILFLSCVNFR*FDRNSSSASFVAALAYSGARDLQWPHHGA*NSTKMYSVVVITV 136 IL LSC+ F+ SSS S + AL G + + HH + + Y ++ + V Sbjct: 9 ILLLSCIAFKLACCFSSSISSLKALPLVGHLEFEHVHHASKDFGNRYQLIPLAV 62 >At1g07700.3 68414.m00829 thioredoxin family protein low similarity to thioredoxin [Gallus gallus] GI:212766; contains Pfam profile: PF00085 Thioredoxin Length = 217 Score = 28.7 bits (61), Expect = 3.9 Identities = 10/35 (28%), Positives = 19/35 (54%) Frame = +2 Query: 149 TTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEE 253 T ++V+FY CG CK + ++K + ++E Sbjct: 119 TNSLVVVDFYRTACGSCKYIEQGFSKLCKQSGDQE 153 >At1g07700.2 68414.m00827 thioredoxin family protein low similarity to thioredoxin [Gallus gallus] GI:212766; contains Pfam profile: PF00085 Thioredoxin Length = 171 Score = 28.7 bits (61), Expect = 3.9 Identities = 10/35 (28%), Positives = 19/35 (54%) Frame = +2 Query: 149 TTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEE 253 T ++V+FY CG CK + ++K + ++E Sbjct: 106 TNSLVVVDFYRTACGSCKYIEQGFSKLCKQSGDQE 140 >At1g07700.1 68414.m00828 thioredoxin family protein low similarity to thioredoxin [Gallus gallus] GI:212766; contains Pfam profile: PF00085 Thioredoxin Length = 204 Score = 28.7 bits (61), Expect = 3.9 Identities = 10/35 (28%), Positives = 19/35 (54%) Frame = +2 Query: 149 TTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEE 253 T ++V+FY CG CK + ++K + ++E Sbjct: 106 TNSLVVVDFYRTACGSCKYIEQGFSKLCKQSGDQE 140 >At4g14210.2 68417.m02193 phytoene dehydrogenase, chloroplast / phytoene desaturase (PDS) identical to SP|Q07356 Phytoene dehydrogenase, chloroplast precursor (EC 1.14.99.-) (Phytoene desaturase){Arabidopsis thaliana}; high similarity to phytoene desaturase [Lycopersicon esculentum][GI:19287] Length = 566 Score = 28.3 bits (60), Expect = 5.2 Identities = 17/53 (32%), Positives = 27/53 (50%) Frame = -3 Query: 513 LVEKKPNTITVLASISSLACSARGDLNSRXASLLLQPTDDVISLTTT*IVDXT 355 L+ + N ++V A +S L C D N L+ P ++ IS T + I+D T Sbjct: 409 LLFSRSNLLSVYADMS-LTCKEYYDPNRSMLELVFAPAEEWISRTDSDIIDAT 460 >At4g14210.1 68417.m02192 phytoene dehydrogenase, chloroplast / phytoene desaturase (PDS) identical to SP|Q07356 Phytoene dehydrogenase, chloroplast precursor (EC 1.14.99.-) (Phytoene desaturase){Arabidopsis thaliana}; high similarity to phytoene desaturase [Lycopersicon esculentum][GI:19287] Length = 566 Score = 28.3 bits (60), Expect = 5.2 Identities = 17/53 (32%), Positives = 27/53 (50%) Frame = -3 Query: 513 LVEKKPNTITVLASISSLACSARGDLNSRXASLLLQPTDDVISLTTT*IVDXT 355 L+ + N ++V A +S L C D N L+ P ++ IS T + I+D T Sbjct: 409 LLFSRSNLLSVYADMS-LTCKEYYDPNRSMLELVFAPAEEWISRTDSDIIDAT 460 >At3g53220.1 68416.m05864 thioredoxin family protein low similarity to SP|P29451 Thioredoxin [Rhesus macaque] {Macaca mulatta}; contains Pfam profile: PF00085 Thioredoxin Length = 126 Score = 28.3 bits (60), Expect = 5.2 Identities = 8/32 (25%), Positives = 18/32 (56%) Frame = +2 Query: 164 LVEFYAPWCGHCKSLAPEYAKAATKLAEEEFL 259 ++ + A WCG C + P + K + ++ +F+ Sbjct: 47 VINYGASWCGVCSQILPAFRKLSNSFSKLKFV 78 >At1g11530.1 68414.m01324 thioredoxin family protein similar to thioredoxin H-type from Arabidopsis thaliana SP|P29448, Nicotiana tabacum SP|Q07090; contains Pfam profile: PF00085 Thioredoxin Length = 118 Score = 28.3 bits (60), Expect = 5.2 Identities = 12/41 (29%), Positives = 22/41 (53%) Frame = +1 Query: 274 VDATQEQDLAESYGVRGYPTLKFFRNGSXIDYSGGRQADDI 396 VD + +++A V+ PT F ++G+ +D G D+I Sbjct: 61 VDVDEVKEVASQLEVKAMPTFLFLKDGNAMDKLVGANPDEI 101 >At4g19520.1 68417.m02872 disease resistance protein (TIR-NBS-LRR class), putative domain signature TIR-NBS-LRR exists, suggestive of a disease resistance protein. Length = 1129 Score = 27.9 bits (59), Expect = 6.8 Identities = 21/79 (26%), Positives = 38/79 (48%), Gaps = 9/79 (11%) Frame = +1 Query: 187 VRPLQISGTGIRQGSN---KAG*RRIPIKLAKVDATQEQD------LAESYGVRGYPTLK 339 +R L + GTGIR S+ + +R+ KL V ++ + L +S + P + Sbjct: 672 IRKLHLQGTGIRDLSSLNHSSESQRLTRKLENVSSSNQDHRKQVLKLKDSSHLGSLPDIV 731 Query: 340 FFRNGSXIDYSGGRQADDI 396 F + +D+SG + +DI Sbjct: 732 IFESLEVLDFSGCSELEDI 750 >At3g56420.1 68416.m06275 thioredoxin family protein similar to thioredoxin [Nicotiana tabacum] GI:20047; contains Pfam profile: PF00085 Thioredoxin Length = 100 Score = 27.5 bits (58), Expect = 9.0 Identities = 13/46 (28%), Positives = 23/46 (50%), Gaps = 1/46 (2%) Frame = +2 Query: 179 APWCGHCKSLAPEYAKAATKLAEEEFLS-N*RKLTQLKNRISPRAT 313 APWC CK + P + A++ F++ + +L + N + AT Sbjct: 17 APWCVPCKKIEPVFRDLASRYPSMIFVTVDVEELAEFSNEWNVEAT 62 >At2g42580.1 68415.m05269 tetratricopeptide repeat (TPR)-containing protein contains Pfam profile PF00515 TPR Domain Length = 691 Score = 27.5 bits (58), Expect = 9.0 Identities = 10/30 (33%), Positives = 17/30 (56%) Frame = +1 Query: 274 VDATQEQDLAESYGVRGYPTLKFFRNGSXI 363 VD + LA++ +R PT K ++NG + Sbjct: 642 VDVEESMALAKAESIRKVPTFKMYKNGDKV 671 >At1g53300.1 68414.m06041 thioredoxin family protein contains Pfam profiles PF00085: Thioredoxin, PF00515: TPR Domain; similar to tetratricopeptide repeat protein 2 (GI:7248701) [Drosophila melanogaster]; similar to DnaJ homolog subfamily C member 7 (Tetratricopeptide repeat protein 2) (TPR repeat protein 2) (Swiss-Prot:Q99615) [Homo sapiens] Length = 699 Score = 27.5 bits (58), Expect = 9.0 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = +1 Query: 259 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSXI 363 I KVD + + + VR PT+K ++NGS + Sbjct: 645 IHFLKVDIDKCPSIGNAENVRVVPTVKIYKNGSRV 679 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,036,515 Number of Sequences: 28952 Number of extensions: 266070 Number of successful extensions: 805 Number of sequences better than 10.0: 69 Number of HSP's better than 10.0 without gapping: 721 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 795 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1496852856 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -