BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30830.Seq (535 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein ... 23 2.0 DQ257416-1|ABB81847.1| 552|Apis mellifera yellow-h protein. 22 4.5 >AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein 1 protein. Length = 500 Score = 23.0 bits (47), Expect = 2.0 Identities = 9/47 (19%), Positives = 18/47 (38%) Frame = -3 Query: 206 HATCLXMVYFVWHTLXNCTIASDVYNVSNFVHFHVRGERNSSMCAEP 66 H L V + CT+ + + + H++ +SS+ P Sbjct: 245 HVLKLHQVAHYGEKVYKCTLCHETFGSKKTMELHIKTHSDSSVVGSP 291 >DQ257416-1|ABB81847.1| 552|Apis mellifera yellow-h protein. Length = 552 Score = 21.8 bits (44), Expect = 4.5 Identities = 6/16 (37%), Positives = 10/16 (62%) Frame = -3 Query: 173 WHTLXNCTIASDVYNV 126 WHT+ NC + V+ + Sbjct: 236 WHTVGNCDGLTSVFRI 251 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 107,104 Number of Sequences: 438 Number of extensions: 1581 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 15090993 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -