BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30829.Seq (598 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090824-1|BAC57923.1| 298|Anopheles gambiae gag-like protein p... 25 1.4 AJ292755-1|CAC00630.1| 837|Anopheles gambiae integrin beta subu... 23 9.9 >AB090824-1|BAC57923.1| 298|Anopheles gambiae gag-like protein protein. Length = 298 Score = 25.4 bits (53), Expect = 1.4 Identities = 14/32 (43%), Positives = 18/32 (56%), Gaps = 2/32 (6%) Frame = -1 Query: 568 GAICGKNWXAXGRESF--IVADMGEVYIQPVE 479 GA+ GK A G +VADMGEV I ++ Sbjct: 129 GAVLGKIHEAVGESGTARVVADMGEVIIPNID 160 >AJ292755-1|CAC00630.1| 837|Anopheles gambiae integrin beta subunit protein. Length = 837 Score = 22.6 bits (46), Expect = 9.9 Identities = 10/35 (28%), Positives = 19/35 (54%) Frame = +1 Query: 4 PKLSLCGLVLSVWGIIQLTLMGVFYYIRAVALLED 108 PK+ + G+VL+V ++ L M V + + + D Sbjct: 764 PKVFMLGIVLAVIAVVVLIGMAVLLLWKVLTSIHD 798 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 527,289 Number of Sequences: 2352 Number of extensions: 8376 Number of successful extensions: 15 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 57609459 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -