BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30824.Seq (641 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g60670.1 68418.m07614 60S ribosomal protein L12 (RPL12C) 60S ... 139 1e-33 At3g53430.1 68416.m05896 60S ribosomal protein L12 (RPL12B) 60S ... 135 3e-32 At2g37190.1 68415.m04562 60S ribosomal protein L12 (RPL12A) 135 3e-32 At2g31890.1 68415.m03896 expressed protein 28 4.6 At1g15500.1 68414.m01865 chloroplast ADP, ATP carrier protein, p... 28 4.6 At3g54230.1 68416.m05994 zinc finger protein-related / D111/G-pa... 28 6.1 At3g47110.1 68416.m05115 leucine-rich repeat transmembrane prote... 28 6.1 At1g51450.1 68414.m05791 SPla/RYanodine receptor (SPRY) domain-c... 28 6.1 >At5g60670.1 68418.m07614 60S ribosomal protein L12 (RPL12C) 60S RIBOSOMAL PROTEIN L12 (like), Arabidopsis thaliana, PIR:T45883 Length = 166 Score = 139 bits (337), Expect = 1e-33 Identities = 66/85 (77%), Positives = 78/85 (91%) Frame = +3 Query: 252 KDWKGLKITVQLTVQNRQAQIAVVPSAAALIIRALKEPPRDRKKQKNIKHNGNISLEDVI 431 K+WKGL++TV+LTVQNRQA++ VVPSAAAL+I+ALKEP RDRKK KNIKHNGNIS +DVI Sbjct: 52 KEWKGLRVTVKLTVQNRQAKVTVVPSAAALVIKALKEPERDRKKVKNIKHNGNISFDDVI 111 Query: 432 GIAKIMRNRSMARYLSGSVKEILGT 506 IAKIMR RS+A+ LSG+VKEILGT Sbjct: 112 EIAKIMRPRSIAKELSGTVKEILGT 136 Score = 79.8 bits (188), Expect = 1e-15 Identities = 36/50 (72%), Positives = 42/50 (84%) Frame = +1 Query: 103 MPPKFDPNEIKIVNLRCVGGEVGATSSLAPKIGPLGLSPKKVGDDIAKAT 252 MPPK DP++I V +R GGEVGA SSLAPKIGPLGL+PKK+G+DIAK T Sbjct: 1 MPPKLDPSQIVDVYVRVTGGEVGAASSLAPKIGPLGLAPKKIGEDIAKET 50 Score = 33.1 bits (72), Expect = 0.16 Identities = 14/25 (56%), Positives = 18/25 (72%) Frame = +2 Query: 512 SVGCTVXGRPPHDLIDDIXSGXLTI 586 SVGCTV G+ P DL ++I SG + I Sbjct: 139 SVGCTVDGKDPKDLQEEINSGDIDI 163 >At3g53430.1 68416.m05896 60S ribosomal protein L12 (RPL12B) 60S RIBOSOMAL PROTEIN L12, Prunus armeniaca, SWISSPROT:RL12_PRUAR Length = 166 Score = 135 bits (326), Expect = 3e-32 Identities = 63/85 (74%), Positives = 77/85 (90%) Frame = +3 Query: 252 KDWKGLKITVQLTVQNRQAQIAVVPSAAALIIRALKEPPRDRKKQKNIKHNGNISLEDVI 431 K+WKGL++TV+LTVQNRQA++ VVPSAAAL+I+ALKEP RDRKK KNIKHNGNIS +DV Sbjct: 52 KEWKGLRVTVKLTVQNRQAKVTVVPSAAALVIKALKEPERDRKKVKNIKHNGNISFDDVT 111 Query: 432 GIAKIMRNRSMARYLSGSVKEILGT 506 IA+IMR RS+A+ LSG+V+EILGT Sbjct: 112 EIARIMRPRSIAKELSGTVREILGT 136 Score = 79.8 bits (188), Expect = 1e-15 Identities = 36/50 (72%), Positives = 42/50 (84%) Frame = +1 Query: 103 MPPKFDPNEIKIVNLRCVGGEVGATSSLAPKIGPLGLSPKKVGDDIAKAT 252 MPPK DP++I V +R GGEVGA SSLAPKIGPLGL+PKK+G+DIAK T Sbjct: 1 MPPKLDPSQIVDVYVRVTGGEVGAASSLAPKIGPLGLAPKKIGEDIAKET 50 Score = 30.7 bits (66), Expect = 0.86 Identities = 13/25 (52%), Positives = 16/25 (64%) Frame = +2 Query: 512 SVGCTVXGRPPHDLIDDIXSGXLTI 586 SVGCTV G+ P DL +I G + I Sbjct: 139 SVGCTVDGKDPKDLQQEIQEGEIEI 163 >At2g37190.1 68415.m04562 60S ribosomal protein L12 (RPL12A) Length = 166 Score = 135 bits (326), Expect = 3e-32 Identities = 63/85 (74%), Positives = 77/85 (90%) Frame = +3 Query: 252 KDWKGLKITVQLTVQNRQAQIAVVPSAAALIIRALKEPPRDRKKQKNIKHNGNISLEDVI 431 K+WKGL++TV+LTVQNRQA++ VVPSAAAL+I+ALKEP RDRKK KNIKHNGNIS +DV Sbjct: 52 KEWKGLRVTVKLTVQNRQAKVTVVPSAAALVIKALKEPERDRKKVKNIKHNGNISFDDVT 111 Query: 432 GIAKIMRNRSMARYLSGSVKEILGT 506 IA+IMR RS+A+ LSG+V+EILGT Sbjct: 112 EIARIMRPRSIAKELSGTVREILGT 136 Score = 79.8 bits (188), Expect = 1e-15 Identities = 36/50 (72%), Positives = 42/50 (84%) Frame = +1 Query: 103 MPPKFDPNEIKIVNLRCVGGEVGATSSLAPKIGPLGLSPKKVGDDIAKAT 252 MPPK DP++I V +R GGEVGA SSLAPKIGPLGL+PKK+G+DIAK T Sbjct: 1 MPPKLDPSQIVDVYVRVTGGEVGAASSLAPKIGPLGLAPKKIGEDIAKET 50 Score = 29.5 bits (63), Expect = 2.0 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = +2 Query: 512 SVGCTVXGRPPHDLIDDIXSGXLTI 586 SVGCTV G+ P D+ +I G + I Sbjct: 139 SVGCTVDGKDPKDIQQEIQDGEVEI 163 >At2g31890.1 68415.m03896 expressed protein Length = 671 Score = 28.3 bits (60), Expect = 4.6 Identities = 16/36 (44%), Positives = 22/36 (61%) Frame = +3 Query: 360 EPPRDRKKQKNIKHNGNISLEDVIGIAKIMRNRSMA 467 +PP+ RKKQKN K +LED G+ +R R +A Sbjct: 112 QPPKKRKKQKNSK-----ALEDTEGMDWCVRARKIA 142 >At1g15500.1 68414.m01865 chloroplast ADP, ATP carrier protein, putative / ADP, ATP translocase, putative / adenine nucleotide translocase, putative strong similarity to SP|Q39002 Chloroplast ADP,ATP carrier protein 1, chloroplast precursor (ADP/ATP translocase 1) (Adenine nucleotide translocase 1) {Arabidopsis thaliana}; contains Pfam profile PF03219: TLC ATP/ADP transporter Length = 618 Score = 28.3 bits (60), Expect = 4.6 Identities = 10/23 (43%), Positives = 18/23 (78%) Frame = -2 Query: 445 IFAMPITSSREMLPLCLIFFCFL 377 IF + +T+ ++++PL L+FFC L Sbjct: 102 IFGVEVTTLKKIVPLGLMFFCIL 124 >At3g54230.1 68416.m05994 zinc finger protein-related / D111/G-patch domain-containing protein / RNA recognition motif (RRM)-containing protein KIAA0122 gene , Homo sapiens, EMBL:HSDKG02; contains Pfam profiles PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain), PF01585: G-patch domain, weak hit to PF00641: Zn-finger in Ran binding protein and others Length = 1105 Score = 27.9 bits (59), Expect = 6.1 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = -3 Query: 609 YWKPFNPSMVKXPLXMSSIRSCGGLPSTVHPTDWLC 502 Y +P + V +S RS GG + + PTDW+C Sbjct: 375 YSQPTGRAGVSRRQEHASRRSYGGSRNMIVPTDWIC 410 >At3g47110.1 68416.m05115 leucine-rich repeat transmembrane protein kinase, putative protein kinase Xa21 receptor type precursor, Oryza sativa, PIR:A57676 Length = 1025 Score = 27.9 bits (59), Expect = 6.1 Identities = 11/44 (25%), Positives = 25/44 (56%) Frame = -2 Query: 481 PERYRAIDLFLMIFAMPITSSREMLPLCLIFFCFLRSRGGSLRA 350 P R+ ++ + I + ++ +L LC+++ C+ + R S+RA Sbjct: 645 PRRHSSVRKIITICVSAVMAALLLLCLCVVYLCWYKLRVKSVRA 688 >At1g51450.1 68414.m05791 SPla/RYanodine receptor (SPRY) domain-containing protein low similarity to DEAD box protein DDX1 [Gallus gallus] GI:16323037, ryanodine receptor [Caenorhabditis elegans] GI:1871447; contains Pfam profile PF00622: SPRY domain Length = 509 Score = 27.9 bits (59), Expect = 6.1 Identities = 16/55 (29%), Positives = 24/55 (43%) Frame = +3 Query: 249 HKDWKGLKITVQLTVQNRQAQIAVVPSAAALIIRALKEPPRDRKKQKNIKHNGNI 413 HK K L + V+ + V+PS A ++ A KK K+ K N N+ Sbjct: 172 HKKLKQLDCLTSVAVKEEEEPEQVLPSEAMVVEEAATLVASAAKKSKSKKKNNNV 226 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,168,138 Number of Sequences: 28952 Number of extensions: 297833 Number of successful extensions: 742 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 705 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 742 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1324661040 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -