BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30818.Seq (461 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ138189-1|ABA03053.1| 162|Tribolium castaneum bursicon protein. 22 3.2 AJ518940-1|CAD57734.1| 361|Tribolium castaneum extradenticle pr... 21 5.6 >DQ138189-1|ABA03053.1| 162|Tribolium castaneum bursicon protein. Length = 162 Score = 21.8 bits (44), Expect = 3.2 Identities = 12/37 (32%), Positives = 17/37 (45%), Gaps = 2/37 (5%) Frame = -2 Query: 307 PIPSNSCF*IKSG--NTNRRRGWQSPRCQPCCRERAE 203 PIPS +C + + + WQ R CC+E E Sbjct: 59 PIPSFACIGRCASYIQVSGSKIWQMERSCMCCQESGE 95 >AJ518940-1|CAD57734.1| 361|Tribolium castaneum extradenticle protein. Length = 361 Score = 21.0 bits (42), Expect = 5.6 Identities = 7/14 (50%), Positives = 10/14 (71%) Frame = +3 Query: 372 NQF*YEHISNSYRS 413 N++ Y H+SN Y S Sbjct: 246 NEYFYSHLSNPYPS 259 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 105,975 Number of Sequences: 336 Number of extensions: 2077 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 122,585 effective HSP length: 52 effective length of database: 105,113 effective search space used: 10616413 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -