BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30792.Seq (698 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY137766-1|AAM94344.1| 78|Anopheles gambiae heat shock protein... 52 2e-08 AY347946-1|AAR28374.1| 640|Anopheles gambiae putative NPY GPCR ... 25 1.7 AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. 24 4.0 >AY137766-1|AAM94344.1| 78|Anopheles gambiae heat shock protein 70 protein. Length = 78 Score = 51.6 bits (118), Expect = 2e-08 Identities = 28/40 (70%), Positives = 29/40 (72%) Frame = +3 Query: 579 INEPTAAAIAYGLDKXGTGERNVLYL*TSAAVTFDVSILT 698 INEPTAAA+AYGLDK GERNVL TFDVSILT Sbjct: 33 INEPTAAALAYGLDKNLKGERNVLIFDLGGG-TFDVSILT 71 Score = 34.7 bits (76), Expect = 0.003 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 511 NDSQRQATKDAGTISGL 561 NDSQRQATKDAG I+GL Sbjct: 11 NDSQRQATKDAGAIAGL 27 Score = 26.6 bits (56), Expect = 0.75 Identities = 15/32 (46%), Positives = 19/32 (59%) Frame = +2 Query: 482 NAVITVPAYSMTLKDKPQKMQVPSLGLNVLRI 577 +AVITVPAY + + K GLNV+RI Sbjct: 1 DAVITVPAYFNDSQRQATKDAGAIAGLNVMRI 32 >AY347946-1|AAR28374.1| 640|Anopheles gambiae putative NPY GPCR protein. Length = 640 Score = 25.4 bits (53), Expect = 1.7 Identities = 13/34 (38%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Frame = -3 Query: 261 IVCWGSSPPGSWRHLR*DARCL*TQHK-TEWSCC 163 IV WG PPG + R D R ++ K ++ +CC Sbjct: 329 IVVWGKRPPGEAENSR-DQRMAKSKRKFSQQNCC 361 >AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. Length = 3361 Score = 24.2 bits (50), Expect = 4.0 Identities = 14/36 (38%), Positives = 20/36 (55%), Gaps = 2/36 (5%) Frame = +2 Query: 62 NGKSTRSRNRSGYHVLLRWCLPAREGGDHR--QRPG 163 +GK RS + +++LL P REG H+ Q PG Sbjct: 1802 DGKYKRSYSYEPHNLLLSNLFPPREGFHHKAVQLPG 1837 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 765,509 Number of Sequences: 2352 Number of extensions: 16886 Number of successful extensions: 33 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 31 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 33 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 71086350 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -