BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30787.Seq (698 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 5e-19 SB_36408| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 9e-17 SB_28728| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 1e-16 SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 2e-16 SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40) 82 4e-16 SB_58985| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 1e-15 SB_19310| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 3e-15 SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) 78 8e-15 SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) 77 2e-14 SB_35685| Best HMM Match : Ribosomal_S8 (HMM E-Value=0.08) 76 3e-14 SB_14300| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_9428| Best HMM Match : Vicilin_N (HMM E-Value=4.2) 76 3e-14 SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 6e-14 SB_20904| Best HMM Match : Filament_head (HMM E-Value=10) 75 6e-14 SB_24787| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 7e-14 SB_8714| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 7e-14 SB_43339| Best HMM Match : SAC3_GANP (HMM E-Value=1.8e-09) 75 7e-14 SB_7086| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 7e-14 SB_46374| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 1e-13 SB_40610| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 1e-13 SB_14936| Best HMM Match : Pep_M12B_propep (HMM E-Value=9.7) 74 1e-13 SB_45900| Best HMM Match : Chordopox_A13L (HMM E-Value=7.4) 74 1e-13 SB_42069| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 1e-13 SB_41481| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 1e-13 SB_7849| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 1e-13 SB_2468| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 1e-13 SB_36598| Best HMM Match : E-MAP-115 (HMM E-Value=0.092) 74 1e-13 SB_11962| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 1e-13 SB_46308| Best HMM Match : IMS (HMM E-Value=0) 73 2e-13 SB_37536| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_18796| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_15873| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_7261| Best HMM Match : RHS (HMM E-Value=5.3) 73 2e-13 SB_55138| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_30551| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_19009| Best HMM Match : Sperm_Ag_HE2 (HMM E-Value=2.3) 73 2e-13 SB_8218| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_7769| Best HMM Match : Histone (HMM E-Value=0.2) 73 2e-13 SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) 73 2e-13 SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) 73 2e-13 SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) 73 2e-13 SB_51749| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_51748| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016) 73 2e-13 SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6) 73 2e-13 SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_46589| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_46412| Best HMM Match : HEAT (HMM E-Value=8) 73 2e-13 SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) 73 2e-13 SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_45291| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_44894| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_44606| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_44358| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_43671| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_43630| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_43569| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_43145| Best HMM Match : PEGSRP (HMM E-Value=7.2) 73 2e-13 SB_42831| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_42725| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_42655| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_42158| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_41806| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_41728| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_41712| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_40939| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_40566| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_40462| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_39373| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_39201| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_38916| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_38016| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_37690| Best HMM Match : IgG_binding_B (HMM E-Value=4.2) 73 2e-13 SB_37661| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_37412| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9) 73 2e-13 SB_36865| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_36681| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_35997| Best HMM Match : Phage_fiber (HMM E-Value=0.78) 73 2e-13 SB_35689| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) 73 2e-13 SB_34829| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_34793| Best HMM Match : TIL (HMM E-Value=4.5) 73 2e-13 SB_34683| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_34501| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_34015| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_33403| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_33270| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_32674| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_32508| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_32411| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_32110| Best HMM Match : PEGSRP (HMM E-Value=9.6) 73 2e-13 SB_31658| Best HMM Match : Arm (HMM E-Value=0.91) 73 2e-13 SB_31056| Best HMM Match : Virus_P-coat (HMM E-Value=6.4) 73 2e-13 SB_30810| Best HMM Match : JmjC (HMM E-Value=0.0021) 73 2e-13 SB_30786| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_30192| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_29084| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_28922| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_28866| Best HMM Match : PhdYeFM (HMM E-Value=8.3) 73 2e-13 SB_28269| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_27927| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_27779| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_27619| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_27047| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_25936| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_24859| Best HMM Match : HAP (HMM E-Value=6.4) 73 2e-13 SB_24544| Best HMM Match : PSCyt1 (HMM E-Value=4.3) 73 2e-13 SB_24181| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_23437| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_22658| Best HMM Match : Protamine_3 (HMM E-Value=9.6) 73 2e-13 SB_22468| Best HMM Match : CUT (HMM E-Value=6.8) 73 2e-13 SB_22375| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_22254| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_21247| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_20864| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_20839| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_20747| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_19461| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_18812| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_18436| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_18289| Best HMM Match : IgG_binding_B (HMM E-Value=7) 73 2e-13 SB_17565| Best HMM Match : EGF (HMM E-Value=5.1e-05) 73 2e-13 SB_16725| Best HMM Match : DAGAT (HMM E-Value=1e-39) 73 2e-13 SB_16155| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_15493| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_15346| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_15295| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_15150| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_15134| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_15127| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_14862| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_14045| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_13480| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_13372| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_13236| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_12962| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_12873| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_12726| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_12236| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_12187| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_12019| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_11632| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_11249| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_10911| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_10687| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_10456| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_10031| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_9995| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_9697| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_9450| Best HMM Match : CM_1 (HMM E-Value=3.1) 73 2e-13 SB_8806| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_8621| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_8582| Best HMM Match : CsgG (HMM E-Value=4.9e-06) 73 2e-13 SB_8530| Best HMM Match : ThiC (HMM E-Value=2.7e-07) 73 2e-13 SB_8498| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_7973| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_7142| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_6842| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_6464| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_6117| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_5521| Best HMM Match : SWIM (HMM E-Value=6.9) 73 2e-13 SB_5457| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_4705| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_4191| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_4190| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_3728| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_3676| Best HMM Match : Cuticle_2 (HMM E-Value=3.2) 73 2e-13 SB_2230| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_1204| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_965| Best HMM Match : IgG_binding_B (HMM E-Value=8.5) 73 2e-13 SB_58797| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_55779| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_55121| Best HMM Match : DUF971 (HMM E-Value=8.5) 73 2e-13 SB_55030| Best HMM Match : Toxin_27 (HMM E-Value=1.2) 73 2e-13 SB_54995| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_54425| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_54421| Best HMM Match : HipA_C (HMM E-Value=7.5) 73 2e-13 SB_53532| Best HMM Match : IgG_binding_B (HMM E-Value=7.8) 73 2e-13 SB_52081| Best HMM Match : DUF1634 (HMM E-Value=0.55) 73 2e-13 SB_51954| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_51949| Best HMM Match : Toxin_14 (HMM E-Value=0.051) 73 2e-13 SB_51352| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_51253| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_49112| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_48731| Best HMM Match : zf-C3HC4 (HMM E-Value=6.5e-08) 73 2e-13 SB_48358| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_46185| Best HMM Match : Flt3_lig (HMM E-Value=3.3) 73 2e-13 SB_45537| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_45065| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_44512| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_44400| Best HMM Match : AT_hook (HMM E-Value=3.3) 73 2e-13 SB_43660| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_42664| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_42518| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_41564| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_41244| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_40229| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_39279| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_36908| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_35835| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_34678| Best HMM Match : Bromodomain (HMM E-Value=9e-25) 73 2e-13 SB_34602| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_32133| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_31269| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_31079| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_30664| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_28552| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_27244| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_26386| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_25785| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_22440| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_20758| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_20651| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_20620| Best HMM Match : zf-HIT (HMM E-Value=8.5e-10) 73 2e-13 SB_19831| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_19077| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_16729| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_15849| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_12231| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_12047| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_11928| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_11382| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_11225| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_9128| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_8032| Best HMM Match : IBB (HMM E-Value=0.46) 73 2e-13 SB_7742| Best HMM Match : HEAT (HMM E-Value=9e-23) 73 2e-13 SB_7402| Best HMM Match : Extensin_2 (HMM E-Value=2) 73 2e-13 SB_6875| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_5394| Best HMM Match : PEGSRP (HMM E-Value=1.5) 73 2e-13 SB_2918| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_1078| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_969| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_51515| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_41202| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_15339| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_55134| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_54335| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_4560| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_29340| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_51296| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_50972| Best HMM Match : MH1 (HMM E-Value=7.1) 72 4e-13 SB_36723| Best HMM Match : DUF753 (HMM E-Value=9.9) 72 4e-13 SB_16182| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_4528| Best HMM Match : Antistasin (HMM E-Value=8.4) 72 4e-13 SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 72 5e-13 SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 72 5e-13 SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_57634| Best HMM Match : EGF_2 (HMM E-Value=0.0014) 72 5e-13 SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_57287| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 72 5e-13 SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) 72 5e-13 SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) 72 5e-13 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) 72 5e-13 SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 72 5e-13 SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1) 72 5e-13 SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3) 72 5e-13 SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) 72 5e-13 SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) 72 5e-13 SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_52253| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29) 72 5e-13 SB_51427| Best HMM Match : DUF855 (HMM E-Value=4) 72 5e-13 SB_51409| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_51320| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) 72 5e-13 SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_50493| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_50417| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_50270| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_49896| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_49839| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_49814| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_49530| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_49465| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_49395| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_49211| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_49150| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) 72 5e-13 SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_48522| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_48514| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_48486| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_48129| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_48100| Best HMM Match : Transformer (HMM E-Value=5.4) 72 5e-13 SB_48063| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_48045| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_47536| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_47480| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_47399| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_47213| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_46889| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) 72 5e-13 SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_46529| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_46517| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_46424| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) 72 5e-13 SB_46303| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_45887| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_45813| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_45524| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_45424| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_45381| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_44920| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_44806| Best HMM Match : Hist_deacetyl (HMM E-Value=0) 72 5e-13 SB_44800| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_44789| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) 72 5e-13 SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_44466| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_44411| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_44401| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_44392| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_44259| Best HMM Match : MORN (HMM E-Value=3.7) 72 5e-13 SB_44076| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_44013| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_43970| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) 72 5e-13 SB_43909| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_43701| Best HMM Match : ubiquitin (HMM E-Value=0.003) 72 5e-13 SB_43618| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_43138| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.3e-14) 72 5e-13 SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_42990| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_42937| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_42936| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) 72 5e-13 SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8) 72 5e-13 SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_42313| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_42015| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_41881| Best HMM Match : Extensin_1 (HMM E-Value=5.5) 72 5e-13 SB_41827| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_41779| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_41568| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_41365| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_40471| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_40265| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_40240| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_40230| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_40107| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_39690| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_39438| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_39406| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_39311| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_39107| Best HMM Match : Lyase_8 (HMM E-Value=0.016) 72 5e-13 SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_38893| Best HMM Match : UMPH-1 (HMM E-Value=2.3e-21) 72 5e-13 SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) 72 5e-13 SB_38726| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_38504| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_38387| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_38141| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_37962| Best HMM Match : Tcp10_C (HMM E-Value=5.9e-36) 72 5e-13 SB_37635| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_37372| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_37147| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_37066| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 >SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 91.9 bits (218), Expect = 5e-19 Identities = 42/55 (76%), Positives = 44/55 (80%) Frame = -3 Query: 687 GKGDRCGPSSAITPAGERGMCCKAIKLGNARVFPVTTL*NDGPVNCNTTHYRANW 523 GKGDRCG AITPAGERGMCCKAIKLGNA+ FP + PVNCNTTHYRANW Sbjct: 6 GKGDRCG-LFAITPAGERGMCCKAIKLGNAKGFPSHDVVKRRPVNCNTTHYRANW 59 >SB_36408| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 458 Score = 84.2 bits (199), Expect = 9e-17 Identities = 36/40 (90%), Positives = 37/40 (92%) Frame = +1 Query: 538 VSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 +SRITIHW VLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 277 LSRITIHWPSVLQRRDWENPGVTQLNRLAAHPPFASWRNS 316 >SB_28728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 83.8 bits (198), Expect = 1e-16 Identities = 36/44 (81%), Positives = 38/44 (86%) Frame = +1 Query: 526 IRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 IRPIVSRITIHW +RRDWENPGV QLNRLAAHPPFASW +S Sbjct: 18 IRPIVSRITIHWPSFYKRRDWENPGVNQLNRLAAHPPFASWRSS 61 >SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 83.4 bits (197), Expect = 2e-16 Identities = 40/58 (68%), Positives = 42/58 (72%) Frame = -3 Query: 696 QLFGKGDRCGPSSAITPAGERGMCCKAIKLGNARVFPVTTL*NDGPVNCNTTHYRANW 523 QL G+ G AITPAGERGMCCKAIKLGNA VFP + PVNCNTTHYRANW Sbjct: 11 QLLGRAIGAG-LFAITPAGERGMCCKAIKLGNASVFPSHDVVKRRPVNCNTTHYRANW 67 >SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40) Length = 768 Score = 82.2 bits (194), Expect = 4e-16 Identities = 36/45 (80%), Positives = 37/45 (82%) Frame = -3 Query: 657 AITPAGERGMCCKAIKLGNARVFPVTTL*NDGPVNCNTTHYRANW 523 AITPAGERGMCCKAIKLGNA VFP + PVNCNTTHYRANW Sbjct: 9 AITPAGERGMCCKAIKLGNASVFPSHDVVKRRPVNCNTTHYRANW 53 Score = 32.3 bits (70), Expect = 0.39 Identities = 16/35 (45%), Positives = 20/35 (57%) Frame = -2 Query: 664 LFGYYPSWRKGDVLQGD*VG*RQGFPSHDVVKRRP 560 LF P+ +G + +G FPSHDVVKRRP Sbjct: 7 LFAITPAGERGMCCKAIKLGNASVFPSHDVVKRRP 41 >SB_58985| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 229 Score = 80.2 bits (189), Expect = 1e-15 Identities = 43/79 (54%), Positives = 49/79 (62%), Gaps = 2/79 (2%) Frame = +1 Query: 427 IDFKASLNTFIRTMAKI*LALRSEPN*RGARY--PIRPIVSRITIHWAVVLQRRDWENPG 600 +DF F R +KI L PN RG + P+ ++ AVVLQRRDWENPG Sbjct: 95 VDFDYRYTVFYRIQSKIYPPL--PPNIRGKKIGDPLESTCRHASLALAVVLQRRDWENPG 152 Query: 601 VTQLNRLAAHPPFASWGNS 657 VTQLNRLAAHPPFASW NS Sbjct: 153 VTQLNRLAAHPPFASWRNS 171 >SB_19310| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 79.0 bits (186), Expect = 3e-15 Identities = 36/53 (67%), Positives = 39/53 (73%) Frame = +1 Query: 499 PN*RGARYPIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 PN R R P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 1 PNDRAQRDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 53 >SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) Length = 117 Score = 77.8 bits (183), Expect = 8e-15 Identities = 37/58 (63%), Positives = 41/58 (70%) Frame = -3 Query: 696 QLFGKGDRCGPSSAITPAGERGMCCKAIKLGNARVFPVTTL*NDGPVNCNTTHYRANW 523 QL G+ G AITPAGERGMCCK+IKL +A VFP + PVNCNTTHYRANW Sbjct: 5 QLLGRAIGAG-LFAITPAGERGMCCKSIKLAHASVFPSHDVVKRRPVNCNTTHYRANW 61 >SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 237 Score = 76.6 bits (180), Expect = 2e-14 Identities = 39/57 (68%), Positives = 40/57 (70%) Frame = -3 Query: 696 QLFGKGDRCGPSSAITPAGERGMCCKAIKLGNARVFPVTTL*NDGPVNCNTTHYRAN 526 QL G+ G AITPAGERGMCCKAIKLGNAR FP PVNCNTTHYRAN Sbjct: 42 QLLGRSIGAG-LFAITPAGERGMCCKAIKLGNARGFPSHDGEKRRPVNCNTTHYRAN 97 >SB_35685| Best HMM Match : Ribosomal_S8 (HMM E-Value=0.08) Length = 120 Score = 75.8 bits (178), Expect = 3e-14 Identities = 38/44 (86%), Positives = 40/44 (90%) Frame = -1 Query: 467 MVRMNVLSDALKSIHNAEKRGKRQVLIRPCSKVIVKFLTVMMKH 336 MVR+NVL+DAL SI NAEKRGKRQV IRP SKVIVKFLTVMMKH Sbjct: 1 MVRVNVLNDALVSICNAEKRGKRQVQIRPSSKVIVKFLTVMMKH 44 >SB_14300| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 222 Score = 75.8 bits (178), Expect = 3e-14 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = +1 Query: 562 AVVLQRRDWENPGVTQLNRLAAHPPFASWGNSRR 663 AVVLQRRDWENPGVTQLNRLAAHPPFASWGNS + Sbjct: 132 AVVLQRRDWENPGVTQLNRLAAHPPFASWGNSEK 165 >SB_9428| Best HMM Match : Vicilin_N (HMM E-Value=4.2) Length = 122 Score = 75.8 bits (178), Expect = 3e-14 Identities = 43/70 (61%), Positives = 49/70 (70%), Gaps = 1/70 (1%) Frame = -1 Query: 695 NCL-GRAIGAGPLRLLPQLAKGGCAARRLSWVTPGFSQSRRCKTTAQ*IVIRLTIGRIGY 519 NC GR++ A L L QLAKGGCAARRLSWVTPGFSQSRRCKTTA + L + G Sbjct: 4 NCWEGRSVRASSL--LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASAKLACLQVDSRG- 60 Query: 518 RAPRQFGSLR 489 +PRQ G +R Sbjct: 61 -SPRQTGRMR 69 >SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 74.9 bits (176), Expect = 6e-14 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +1 Query: 562 AVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 AVVLQRRDWENPGVTQLNRLAAHPPFASWGNS Sbjct: 68 AVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 99 >SB_20904| Best HMM Match : Filament_head (HMM E-Value=10) Length = 110 Score = 74.9 bits (176), Expect = 6e-14 Identities = 42/73 (57%), Positives = 48/73 (65%), Gaps = 1/73 (1%) Frame = -1 Query: 695 NCL-GRAIGAGPLRLLPQLAKGGCAARRLSWVTPGFSQSRRCKTTAQ*IVIRLTIGRIGY 519 NC GR++ A L L QLAKGGCAARRLSWVTPGFSQSRRCKTTA + L + G Sbjct: 26 NCWEGRSVRASSL--LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASAKLACLQVDSRGS 83 Query: 518 RAPRQFGSLRSAS 480 R F ++ AS Sbjct: 84 PFRRTFNAIEDAS 96 >SB_24787| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 112 Score = 74.5 bits (175), Expect = 7e-14 Identities = 34/50 (68%), Positives = 37/50 (74%) Frame = +1 Query: 508 RGARYPIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 R A P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 14 RAAGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 63 >SB_8714| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 74.5 bits (175), Expect = 7e-14 Identities = 35/59 (59%), Positives = 41/59 (69%) Frame = +1 Query: 481 LALRSEPN*RGARYPIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 + LR++ R P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 10 ILLRNDRKSRHRGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 68 >SB_43339| Best HMM Match : SAC3_GANP (HMM E-Value=1.8e-09) Length = 657 Score = 74.5 bits (175), Expect = 7e-14 Identities = 33/47 (70%), Positives = 36/47 (76%) Frame = +1 Query: 517 RYPIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 +YP ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 20 KYPPESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 66 >SB_7086| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 74.5 bits (175), Expect = 7e-14 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = +1 Query: 562 AVVLQRRDWENPGVTQLNRLAAHPPFASWGNSRR 663 AVVLQRRDWENPGVTQLNRLAAHPPFASWGN+ + Sbjct: 30 AVVLQRRDWENPGVTQLNRLAAHPPFASWGNNEK 63 >SB_46374| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 74.1 bits (174), Expect = 1e-13 Identities = 36/59 (61%), Positives = 42/59 (71%), Gaps = 2/59 (3%) Frame = +1 Query: 487 LRSEPN*RGARY--PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 L+ E N R ++ P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 62 LKIERNRRHRKFGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 120 >SB_40610| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 172 Score = 74.1 bits (174), Expect = 1e-13 Identities = 36/57 (63%), Positives = 39/57 (68%) Frame = +1 Query: 487 LRSEPN*RGARYPIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 L PN G P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 69 LNPNPNPNGD--PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 123 >SB_14936| Best HMM Match : Pep_M12B_propep (HMM E-Value=9.7) Length = 207 Score = 74.1 bits (174), Expect = 1e-13 Identities = 34/54 (62%), Positives = 39/54 (72%) Frame = +1 Query: 496 EPN*RGARYPIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 +PN + P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 105 QPNSQPDGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 158 >SB_45900| Best HMM Match : Chordopox_A13L (HMM E-Value=7.4) Length = 152 Score = 74.1 bits (174), Expect = 1e-13 Identities = 37/53 (69%), Positives = 39/53 (73%), Gaps = 4/53 (7%) Frame = +1 Query: 511 GARYPIRPIVSRITIHW----AVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 G YP P SR + + AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 42 GLNYPFVPKSSRHSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 94 >SB_42069| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 189 Score = 73.7 bits (173), Expect = 1e-13 Identities = 33/47 (70%), Positives = 36/47 (76%) Frame = +1 Query: 517 RYPIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 R P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 94 RDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 140 >SB_41481| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 73.7 bits (173), Expect = 1e-13 Identities = 34/57 (59%), Positives = 39/57 (68%) Frame = +1 Query: 487 LRSEPN*RGARYPIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 + E N + P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 52 INGEDNNQDPGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 108 >SB_7849| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 73.7 bits (173), Expect = 1e-13 Identities = 34/40 (85%), Positives = 35/40 (87%) Frame = +1 Query: 538 VSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 +SRIT AVVLQRRDWEN GVTQLNRLAAHPPFASW NS Sbjct: 88 LSRITNSLAVVLQRRDWENTGVTQLNRLAAHPPFASWRNS 127 >SB_2468| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 287 Score = 73.7 bits (173), Expect = 1e-13 Identities = 33/47 (70%), Positives = 36/47 (76%) Frame = +1 Query: 517 RYPIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 R P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 57 RDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 103 >SB_36598| Best HMM Match : E-MAP-115 (HMM E-Value=0.092) Length = 783 Score = 73.7 bits (173), Expect = 1e-13 Identities = 33/50 (66%), Positives = 37/50 (74%) Frame = +1 Query: 508 RGARYPIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 +G P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 702 QGVGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 751 >SB_11962| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 79 Score = 73.7 bits (173), Expect = 1e-13 Identities = 33/47 (70%), Positives = 36/47 (76%) Frame = +1 Query: 517 RYPIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 R P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 10 RDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 56 >SB_46308| Best HMM Match : IMS (HMM E-Value=0) Length = 1245 Score = 73.3 bits (172), Expect = 2e-13 Identities = 33/50 (66%), Positives = 37/50 (74%) Frame = +1 Query: 508 RGARYPIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 +G P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 1173 QGKGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 1222 Score = 39.1 bits (87), Expect = 0.003 Identities = 21/31 (67%), Positives = 23/31 (74%), Gaps = 1/31 (3%) Frame = -1 Query: 695 NCL-GRAIGAGPLRLLPQLAKGGCAARRLSW 606 NC GR++ A L L QLAKGGCAARRLSW Sbjct: 411 NCWEGRSVRASSL--LRQLAKGGCAARRLSW 439 >SB_37536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 73.3 bits (172), Expect = 2e-13 Identities = 33/53 (62%), Positives = 38/53 (71%) Frame = +1 Query: 499 PN*RGARYPIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P + + P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 39 PTIKASGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 91 >SB_18796| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 73.3 bits (172), Expect = 2e-13 Identities = 43/73 (58%), Positives = 50/73 (68%), Gaps = 1/73 (1%) Frame = -1 Query: 695 NCL-GRAIGAGPLRLLPQLAKGGCAARRLSWVTPGFSQSRRCKTTAQ*IVIRLTIGRIGY 519 NC GR++ A L L QLAKGGCAARRLSWVTPGFSQSRRCKTTA + L + G Sbjct: 4 NCWEGRSVRASSL--LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASAKLACLQVDSRG- 60 Query: 518 RAPRQFGSLRSAS 480 +P Q+ LR +S Sbjct: 61 -SPAQWYGLRFSS 72 >SB_15873| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 185 Score = 73.3 bits (172), Expect = 2e-13 Identities = 33/49 (67%), Positives = 36/49 (73%) Frame = +1 Query: 511 GARYPIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 G P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 88 GVGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 136 >SB_7261| Best HMM Match : RHS (HMM E-Value=5.3) Length = 137 Score = 73.3 bits (172), Expect = 2e-13 Identities = 42/71 (59%), Positives = 46/71 (64%), Gaps = 1/71 (1%) Frame = -1 Query: 695 NCL-GRAIGAGPLRLLPQLAKGGCAARRLSWVTPGFSQSRRCKTTAQ*IVIRLTIGRIGY 519 NC GR++ A L L QLAKGGCAARRLSWVTPGFSQSRRCKTTA + L + G Sbjct: 26 NCWEGRSVRASSL--LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASAKLACLQVDSRGS 83 Query: 518 RAPRQFGSLRS 486 G LRS Sbjct: 84 PLLLDIGDLRS 94 >SB_55138| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 73.3 bits (172), Expect = 2e-13 Identities = 41/68 (60%), Positives = 48/68 (70%), Gaps = 1/68 (1%) Frame = -1 Query: 695 NCL-GRAIGAGPLRLLPQLAKGGCAARRLSWVTPGFSQSRRCKTTAQ*IVIRLTIGRIGY 519 NC GR++ A L L QLAKGGCAARRLSWVTPGFSQSRRCKTTA + L + G Sbjct: 4 NCWEGRSVRASSL--LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASAKLACLQVDSRG- 60 Query: 518 RAPRQFGS 495 +P Q+G+ Sbjct: 61 -SPSQYGT 67 >SB_30551| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 73.3 bits (172), Expect = 2e-13 Identities = 33/45 (73%), Positives = 38/45 (84%), Gaps = 3/45 (6%) Frame = +1 Query: 532 PIVSRITIHW---AVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P++ R+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 50 PVMGRLESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 94 >SB_19009| Best HMM Match : Sperm_Ag_HE2 (HMM E-Value=2.3) Length = 157 Score = 73.3 bits (172), Expect = 2e-13 Identities = 47/81 (58%), Positives = 53/81 (65%), Gaps = 3/81 (3%) Frame = -1 Query: 695 NCL-GRAIGAGPLRLLPQLAKGGCAARRLSWVTPGFSQSRRCKTTAQ*IVIRLTIGRIGY 519 NC GR++ A L L QLAKGGCAARRLSWVTPGFSQSRRCKTTA + L + G Sbjct: 26 NCWEGRSVRASSL--LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASAKLACLQVDSRGS 83 Query: 518 RA--PRQFGSLRSAS*ILAMV 462 A R G RS S I+AM+ Sbjct: 84 PADDSRLLGIPRSRS-IIAMI 103 >SB_8218| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 73.3 bits (172), Expect = 2e-13 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = +1 Query: 562 AVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 AVVLQRRDWENPGVTQLNRLAAHPPF SWGNS Sbjct: 53 AVVLQRRDWENPGVTQLNRLAAHPPFTSWGNS 84 >SB_7769| Best HMM Match : Histone (HMM E-Value=0.2) Length = 150 Score = 73.3 bits (172), Expect = 2e-13 Identities = 33/49 (67%), Positives = 36/49 (73%) Frame = +1 Query: 511 GARYPIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 G P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 53 GVGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 101 >SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 50 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 94 >SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 13 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 57 >SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 37 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 81 >SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 16 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 60 >SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 4 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 48 >SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 17 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 61 >SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 6 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 50 >SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 4 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 48 >SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 917 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 821 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 865 >SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 4 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 48 >SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) Length = 195 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 102 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 146 >SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 27 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 71 >SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 8 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 52 >SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 25 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 69 >SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 7 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 51 >SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 76 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 120 >SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 25 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 69 >SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 120 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 164 >SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 10 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 54 >SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) Length = 234 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 141 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 185 >SB_51749| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 72.9 bits (171), Expect = 2e-13 Identities = 40/71 (56%), Positives = 48/71 (67%), Gaps = 1/71 (1%) Frame = -1 Query: 695 NCL-GRAIGAGPLRLLPQLAKGGCAARRLSWVTPGFSQSRRCKTTAQ*IVIRLTIGRIGY 519 NC GR++ A LL QLAKGGCAARRLSWVTPGFSQSR CKTT +L G++ Y Sbjct: 48 NCWEGRSVRA--CWLLRQLAKGGCAARRLSWVTPGFSQSRGCKTTTS---AKLACGQVDY 102 Query: 518 RAPRQFGSLRS 486 R +F + R+ Sbjct: 103 RGSLRFSNKRA 113 >SB_51748| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 72.9 bits (171), Expect = 2e-13 Identities = 40/71 (56%), Positives = 48/71 (67%), Gaps = 1/71 (1%) Frame = -1 Query: 695 NCL-GRAIGAGPLRLLPQLAKGGCAARRLSWVTPGFSQSRRCKTTAQ*IVIRLTIGRIGY 519 NC GR++ A LL QLAKGGCAARRLSWVTPGFSQSR CKTT +L G++ Y Sbjct: 48 NCWEGRSVRA--CWLLRQLAKGGCAARRLSWVTPGFSQSRGCKTTTS---AKLACGQVDY 102 Query: 518 RAPRQFGSLRS 486 R +F + R+ Sbjct: 103 RGSLRFSNKRA 113 >SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 45 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 89 >SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 9 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 53 >SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 48 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 92 >SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 4 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 48 >SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 88 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 21 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 65 >SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 36 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 80 >SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 28 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 72 >SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 63 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 107 >SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 10 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 54 >SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 45 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 89 >SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016) Length = 318 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 88 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 132 >SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6) Length = 154 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 61 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 105 >SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 16 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 60 >SB_46589| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 562 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 134 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 178 >SB_46412| Best HMM Match : HEAT (HMM E-Value=8) Length = 140 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 47 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 91 >SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) Length = 181 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 88 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 132 >SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 20 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 64 >SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 113 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 157 >SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 65 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 109 >SB_45291| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 19 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 63 >SB_44894| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 4 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 48 >SB_44606| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 89 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 22 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 66 >SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 24 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 68 >SB_44358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 84 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 128 >SB_43671| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 49 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 93 >SB_43630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 72 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 116 >SB_43569| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 28 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 72 >SB_43145| Best HMM Match : PEGSRP (HMM E-Value=7.2) Length = 165 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 72 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 116 >SB_42831| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 72 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 116 >SB_42725| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 9 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 53 >SB_42655| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 53 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 97 >SB_42158| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 12 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 56 >SB_41806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 4 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 48 >SB_41728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 94 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 12 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 56 >SB_41712| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 198 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 31 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 75 >SB_40939| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 55 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 99 >SB_40566| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 29 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 73 >SB_40462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1580 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 1051 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 1095 >SB_39373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 5 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 49 >SB_39201| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 8 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 52 >SB_38916| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 19 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 63 >SB_38016| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 215 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 122 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 166 >SB_37690| Best HMM Match : IgG_binding_B (HMM E-Value=4.2) Length = 263 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 170 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 214 >SB_37661| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 397 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 158 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 202 >SB_37412| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 7 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 51 >SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9) Length = 227 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 134 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 178 >SB_36865| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 46 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 90 >SB_36681| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1081 Score = 72.9 bits (171), Expect = 2e-13 Identities = 42/79 (53%), Positives = 54/79 (68%), Gaps = 1/79 (1%) Frame = -1 Query: 695 NCL-GRAIGAGPLRLLPQLAKGGCAARRLSWVTPGFSQSRRCKTTAQ*IVIRLTIGRIGY 519 NC GR++ A L L QLAKGGCAARRLSWVTPGFSQSRRCKTTA + L + G Sbjct: 792 NCWEGRSVRASSL--LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASAKLACLQVDSRG- 848 Query: 518 RAPRQFGSLRSAS*ILAMV 462 +P S+R+++ +L ++ Sbjct: 849 -SPNCVFSIRNSACVLPVI 866 >SB_35997| Best HMM Match : Phage_fiber (HMM E-Value=0.78) Length = 197 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 104 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 148 >SB_35689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 11 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 55 >SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) Length = 1060 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 640 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 684 >SB_34829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 27 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 71 >SB_34793| Best HMM Match : TIL (HMM E-Value=4.5) Length = 242 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 149 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 193 >SB_34683| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 102 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 35 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 79 >SB_34501| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 87 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 20 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 64 >SB_34015| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 10 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 54 >SB_33403| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 46 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 90 >SB_33270| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 58 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 102 >SB_32674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 5 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 49 >SB_32508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 115 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 48 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 92 Score = 29.1 bits (62), Expect = 3.6 Identities = 10/14 (71%), Positives = 13/14 (92%) Frame = +1 Query: 616 RLAAHPPFASWGNS 657 +++AHPPFASW NS Sbjct: 14 QVSAHPPFASWRNS 27 >SB_32411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 59 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 103 >SB_32110| Best HMM Match : PEGSRP (HMM E-Value=9.6) Length = 160 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 67 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 111 >SB_31658| Best HMM Match : Arm (HMM E-Value=0.91) Length = 249 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 173 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 217 >SB_31056| Best HMM Match : Virus_P-coat (HMM E-Value=6.4) Length = 154 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 61 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 105 >SB_30810| Best HMM Match : JmjC (HMM E-Value=0.0021) Length = 546 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 254 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 298 >SB_30786| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 8 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 52 >SB_30192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 22 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 66 >SB_29084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 116 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 49 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 93 >SB_28922| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 58 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 102 >SB_28866| Best HMM Match : PhdYeFM (HMM E-Value=8.3) Length = 185 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 92 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 136 >SB_28269| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 51 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 95 >SB_27927| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 61 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 105 >SB_27779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 61 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 105 >SB_27619| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 5 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 49 >SB_27047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 62 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 106 >SB_25936| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 71 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 115 >SB_24859| Best HMM Match : HAP (HMM E-Value=6.4) Length = 257 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 164 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 208 >SB_24544| Best HMM Match : PSCyt1 (HMM E-Value=4.3) Length = 164 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 71 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 115 >SB_24181| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 8 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 52 >SB_23437| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 37 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 81 >SB_22658| Best HMM Match : Protamine_3 (HMM E-Value=9.6) Length = 128 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 61 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 105 >SB_22468| Best HMM Match : CUT (HMM E-Value=6.8) Length = 197 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 130 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 174 >SB_22375| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 16 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 60 >SB_22254| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 56 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 100 >SB_21247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 45 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 89 >SB_20864| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 57 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 101 >SB_20839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 8 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 52 >SB_20747| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 4 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 48 >SB_19461| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 108 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 26 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 70 >SB_18812| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 32 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 76 >SB_18436| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 94 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 27 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 71 >SB_18289| Best HMM Match : IgG_binding_B (HMM E-Value=7) Length = 143 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 50 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 94 >SB_17565| Best HMM Match : EGF (HMM E-Value=5.1e-05) Length = 162 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 69 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 113 >SB_16725| Best HMM Match : DAGAT (HMM E-Value=1e-39) Length = 571 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 179 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 223 >SB_16155| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 168 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 75 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 119 >SB_15493| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 108 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 26 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 70 >SB_15346| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 38 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 82 >SB_15295| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 37 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 81 >SB_15150| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 96 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 29 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 73 >SB_15134| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 10 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 54 >SB_15127| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 8 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 52 >SB_14862| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 31 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 75 >SB_14045| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 57 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 101 >SB_13480| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 43 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 87 >SB_13372| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 6 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 50 >SB_13236| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 42 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 86 >SB_12962| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 76 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 120 >SB_12873| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 43 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 87 >SB_12726| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 46 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 90 >SB_12236| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 8 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 52 >SB_12187| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 82 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 126 >SB_12019| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 53 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 97 >SB_11632| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 248 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 155 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 199 >SB_11249| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 117 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 50 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 94 >SB_10911| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 30 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 74 >SB_10687| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 5 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 49 >SB_10456| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 88 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 21 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 65 >SB_10031| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 67 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 111 >SB_9995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 45 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 89 >SB_9697| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 89 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 22 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 66 >SB_9450| Best HMM Match : CM_1 (HMM E-Value=3.1) Length = 186 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 93 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 137 >SB_8806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 101 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 34 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 78 >SB_8621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 200 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 107 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 151 >SB_8582| Best HMM Match : CsgG (HMM E-Value=4.9e-06) Length = 233 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 140 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 184 >SB_8530| Best HMM Match : ThiC (HMM E-Value=2.7e-07) Length = 183 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 90 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 134 >SB_8498| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 115 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 22 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 66 >SB_7973| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 14 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 58 >SB_7142| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 43 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 87 >SB_6842| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 25 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 69 >SB_6464| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 44 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 88 >SB_6117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 211 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 144 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 188 >SB_5521| Best HMM Match : SWIM (HMM E-Value=6.9) Length = 150 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 57 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 101 >SB_5457| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 207 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 114 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 158 >SB_4705| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 46 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 90 >SB_4191| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 77 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 121 >SB_4190| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 7 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 51 >SB_3728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 6 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 50 >SB_3676| Best HMM Match : Cuticle_2 (HMM E-Value=3.2) Length = 322 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 14 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 58 >SB_2230| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 73 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 117 >SB_1204| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 32 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 76 >SB_965| Best HMM Match : IgG_binding_B (HMM E-Value=8.5) Length = 174 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 81 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 125 >SB_58797| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 200 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 133 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 177 >SB_55779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 60 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 104 >SB_55121| Best HMM Match : DUF971 (HMM E-Value=8.5) Length = 174 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 81 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 125 >SB_55030| Best HMM Match : Toxin_27 (HMM E-Value=1.2) Length = 110 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 43 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 87 >SB_54995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 95 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 139 >SB_54425| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 4 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 48 >SB_54421| Best HMM Match : HipA_C (HMM E-Value=7.5) Length = 248 Score = 72.9 bits (171), Expect = 2e-13 Identities = 49/106 (46%), Positives = 59/106 (55%), Gaps = 1/106 (0%) Frame = -1 Query: 695 NCL-GRAIGAGPLRLLPQLAKGGCAARRLSWVTPGFSQSRRCKTTAQ*IVIRLTIGRIGY 519 NC GR++ A L L QLAKGGCAARRLSWVTPGFSQSRRCKTTA + L + G Sbjct: 26 NCWEGRSVRASSL--LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASAKLACLQVDSRG- 82 Query: 518 RAPRQFGSLRSAS*ILAMVRMNVLSDALKSIHNAEKRGKRQVLIRP 381 +P ++G S A + +L LK K L+RP Sbjct: 83 -SPLRWGPHASKISDKANKVLGLLRRTLKPCSQLVKERAYFTLVRP 127 >SB_53532| Best HMM Match : IgG_binding_B (HMM E-Value=7.8) Length = 162 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 69 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 113 >SB_52081| Best HMM Match : DUF1634 (HMM E-Value=0.55) Length = 189 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 96 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 140 >SB_51954| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 4 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 48 >SB_51949| Best HMM Match : Toxin_14 (HMM E-Value=0.051) Length = 387 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 294 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 338 >SB_51352| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 51 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 95 >SB_51253| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 85 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 18 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 62 >SB_49112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 40 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 84 >SB_48731| Best HMM Match : zf-C3HC4 (HMM E-Value=6.5e-08) Length = 688 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 3 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 47 >SB_48358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 96 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 14 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 58 >SB_46185| Best HMM Match : Flt3_lig (HMM E-Value=3.3) Length = 292 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 41 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 85 >SB_45537| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 4 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 48 >SB_45065| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 44 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 88 >SB_44512| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 215 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 13 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 57 >SB_44400| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 328 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 235 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 279 >SB_43660| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 69 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 113 >SB_42664| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 36 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 80 >SB_42518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 4 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 48 >SB_41564| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 12 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 56 >SB_41244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 268 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 192 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 236 >SB_40229| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 51 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 95 >SB_39279| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 6 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 50 >SB_36908| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 90 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 23 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 67 >SB_35835| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 27 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 71 >SB_34678| Best HMM Match : Bromodomain (HMM E-Value=9e-25) Length = 1137 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 517 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 561 >SB_34602| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 25 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 69 >SB_32133| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 4 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 48 >SB_31269| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 4 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 48 >SB_31079| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 7 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 51 >SB_30664| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 18 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 62 >SB_28552| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 8 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 52 >SB_27244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 73 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 117 >SB_26386| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 20 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 64 >SB_25785| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 190 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 97 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 141 >SB_22440| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 9 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 53 >SB_20758| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 25 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 69 >SB_20651| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 29 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 73 >SB_20620| Best HMM Match : zf-HIT (HMM E-Value=8.5e-10) Length = 567 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 186 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 230 >SB_19831| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 48 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 92 >SB_19077| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 4 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 48 >SB_16729| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 117 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 14 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 58 >SB_15849| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 82 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 15 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 59 >SB_12231| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 523 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHPPFASWGNS 657 P+ ++ AVVLQRRDWENPGVTQLNRLAAHPPFASW NS Sbjct: 8 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 52 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,805,736 Number of Sequences: 59808 Number of extensions: 411546 Number of successful extensions: 8716 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 4675 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8294 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1829596184 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -