BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30782.Seq (598 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_30241| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-05 SB_23696| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_50682| Best HMM Match : CSD (HMM E-Value=2.1e-38) 33 0.13 SB_26212| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.8 SB_51184| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.7 SB_8547| Best HMM Match : Amelogenin (HMM E-Value=8.1) 27 8.7 >SB_30241| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 214 Score = 44.4 bits (100), Expect = 7e-05 Identities = 19/31 (61%), Positives = 24/31 (77%) Frame = +1 Query: 373 KGFEAAGVTGPGGEPVKGSPYAADKRRGYHR 465 +G EA+ VTGP GEPV+GS YA D+RR +R Sbjct: 13 QGLEASNVTGPDGEPVQGSKYAPDRRRRNNR 43 >SB_23696| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 559 Score = 37.5 bits (83), Expect = 0.008 Identities = 29/79 (36%), Positives = 36/79 (45%), Gaps = 2/79 (2%) Frame = +1 Query: 295 ARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGG-EPVKGSPYAADKRRGYHRQY 471 AR +AVR GE +V G G G G GG E V+G+PY ++ G Q Sbjct: 395 AREYLARAVREGLRGEEGSPSVFLGGGGRGGGGGDGGGGGEGVQGTPYTPEEEEGRALQA 454 Query: 472 FPR-QGGGRSGEGVHAEED 525 R GGG GE EE+ Sbjct: 455 CGRGGGGGECGEKEEGEEE 473 >SB_50682| Best HMM Match : CSD (HMM E-Value=2.1e-38) Length = 80 Score = 33.5 bits (73), Expect = 0.13 Identities = 12/21 (57%), Positives = 17/21 (80%) Frame = +2 Query: 185 IAEKVSGTVKWFNVKSGYGFI 247 ++ + +GTVKWFN + GYGFI Sbjct: 12 MSNRQNGTVKWFNDEKGYGFI 32 Score = 30.3 bits (65), Expect = 1.2 Identities = 16/44 (36%), Positives = 25/44 (56%) Frame = +1 Query: 265 EDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGV 396 +D+FVH AI + +S+ +G+AV F G+KG +A V Sbjct: 38 DDLFVHFKAIQSDG----FKSLKEGQAVTFVATRGQKGMQAEEV 77 >SB_26212| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 28.7 bits (61), Expect = 3.8 Identities = 11/17 (64%), Positives = 12/17 (70%) Frame = +3 Query: 414 ASKRLTLCCRQAPWLPP 464 AS T+C RQAPWL P Sbjct: 19 ASPTWTICLRQAPWLSP 35 >SB_51184| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 94 Score = 27.5 bits (58), Expect = 8.7 Identities = 13/36 (36%), Positives = 22/36 (61%) Frame = +1 Query: 481 QGGGRSGEGVHAEED*DSWTPAPTKGVHKEMKVKKE 588 + GGR +GV +EE+ + AP + + KE + K+E Sbjct: 30 KSGGRCLKGVDSEEEGKAILEAPHEEIEKERRSKEE 65 >SB_8547| Best HMM Match : Amelogenin (HMM E-Value=8.1) Length = 201 Score = 27.5 bits (58), Expect = 8.7 Identities = 12/39 (30%), Positives = 16/39 (41%) Frame = -2 Query: 330 DRAHSLTWVVTGDGSLMHKHIFLGVILLMKPYPLLTLNH 214 + H W T D H +F LL PY ++ L H Sbjct: 144 EEGHVTGWSATSDARFEHSALFPARGLLQFPYSVMDLRH 182 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,051,728 Number of Sequences: 59808 Number of extensions: 326303 Number of successful extensions: 1026 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 939 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1025 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1439498375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -