BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30772.Seq (548 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_49958| Best HMM Match : Mak10 (HMM E-Value=7.7) 97 1e-20 SB_41402| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.1 SB_34467| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.9 SB_12344| Best HMM Match : ATP-synt_B (HMM E-Value=1.9) 27 7.6 >SB_49958| Best HMM Match : Mak10 (HMM E-Value=7.7) Length = 176 Score = 96.7 bits (230), Expect = 1e-20 Identities = 45/57 (78%), Positives = 51/57 (89%) Frame = +1 Query: 61 MNVIQAVKMYITKMXEXSGPGMKVILMDKETTSIVSMVYSQSEILQKEVYLFERIDS 231 MNVI AVK Y+TKM E SG GMKV+LMDKETT IVSMVYSQ+E+LQKEVYLFER+D+ Sbjct: 1 MNVILAVKQYVTKMIEESGAGMKVLLMDKETTGIVSMVYSQTEVLQKEVYLFERVDT 57 Score = 44.4 bits (100), Expect(2) = 9e-06 Identities = 19/34 (55%), Positives = 24/34 (70%) Frame = +3 Query: 375 ADIKTLAECDEXEAVRXVQEVFADYLAVDRHLFS 476 A I+ LAE D+ E VR VQE +ADY A+ H+FS Sbjct: 77 ASIRALAEADDQEVVREVQEYYADYFAISPHVFS 110 Score = 22.2 bits (45), Expect(2) = 9e-06 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = +3 Query: 252 EHMKCXVFIRPTSENIALLS 311 +H+K F+RPT +I L+ Sbjct: 64 KHLKAICFLRPTPASIRALA 83 >SB_41402| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 311 Score = 30.3 bits (65), Expect = 1.1 Identities = 15/77 (19%), Positives = 35/77 (45%) Frame = +1 Query: 25 ILCEINKDNLIKMNVIQAVKMYITKMXEXSGPGMKVILMDKETTSIVSMVYSQSEILQKE 204 ++CE+ KD+ K + V + + K E G ++ TT + + ++E+++ Sbjct: 15 LICELGKDDFKKTGLPMCVAIKLQKAIESLDKGKELKTSLDSTTIKANKILKKTELIELS 74 Query: 205 VYLFERIDSHAKWDNMN 255 E +++ W+ N Sbjct: 75 KKSLEAQFANSNWNEFN 91 >SB_34467| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 524 Score = 29.5 bits (63), Expect = 1.9 Identities = 17/46 (36%), Positives = 26/46 (56%), Gaps = 2/46 (4%) Frame = -1 Query: 164 TMLVVSLSINITFIPGPLSSXILVMYIL--TACITFILIKLSLFIS 33 T + SLS ++TF+ GPL++ + Y + A + IL L LF S Sbjct: 57 TAWIASLSFSLTFMLGPLTTSLCTKYGVRSVAVLGAILFALGLFCS 102 >SB_12344| Best HMM Match : ATP-synt_B (HMM E-Value=1.9) Length = 341 Score = 27.5 bits (58), Expect = 7.6 Identities = 16/55 (29%), Positives = 29/55 (52%), Gaps = 3/55 (5%) Frame = -2 Query: 334 YLGSLSSRDNRAM---FSDVGRIKTXHFMCSCYPIWHDCLSSRISKLPSVRFPID 179 YL SL R + ++ + + GR+ T +P + D ++ IS++P V P+D Sbjct: 207 YLRSLRKRQDMSVNTTWPNFGRVTTLVAQDMTFPSYDDVINDVISRVPFVDPPLD 261 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,361,668 Number of Sequences: 59808 Number of extensions: 251717 Number of successful extensions: 405 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 369 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 405 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1264269032 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -