BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30772.Seq (548 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF387862-2|AAL56548.1| 942|Anopheles gambiae pol polyprotein pr... 28 0.23 AJ438610-6|CAD27478.1| 226|Anopheles gambiae hypothetical prote... 26 0.71 U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse tra... 23 6.6 >AF387862-2|AAL56548.1| 942|Anopheles gambiae pol polyprotein protein. Length = 942 Score = 27.9 bits (59), Expect = 0.23 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = +3 Query: 174 VQSIGNLTEGSLLIREDRQSC 236 ++ +G T G ++IRED QSC Sbjct: 849 MKDVGEKTTGPIVIREDNQSC 869 >AJ438610-6|CAD27478.1| 226|Anopheles gambiae hypothetical protein protein. Length = 226 Score = 26.2 bits (55), Expect = 0.71 Identities = 12/31 (38%), Positives = 16/31 (51%) Frame = +3 Query: 261 KCXVFIRPTSENIALLSRELRDPKYGVYFIY 353 KC F RP S ALL+ E + Y + F + Sbjct: 158 KCVPFCRPFSGQTALLTPESQSANYALTFAF 188 >U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse transcriptase protein. Length = 1049 Score = 23.0 bits (47), Expect = 6.6 Identities = 11/33 (33%), Positives = 18/33 (54%) Frame = -1 Query: 146 LSINITFIPGPLSSXILVMYILTACITFILIKL 48 L + + +IP LSS I + L CI+ ++L Sbjct: 183 LYVMVVYIPPQLSSEISTLRSLHDCISSFTLRL 215 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 493,498 Number of Sequences: 2352 Number of extensions: 8511 Number of successful extensions: 13 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 50881347 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -