BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30772.Seq (548 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g77140.1 68414.m08986 vacuolar protein sorting protein 45, pu... 71 7e-13 At4g12120.1 68417.m01924 cytokinesis-related Sec1 protein, putat... 32 0.29 At1g12360.1 68414.m01428 cytokinesis-related Sec1 protein (KEULE... 32 0.29 At3g15060.1 68416.m01905 Ras-related GTP-binding family protein ... 28 3.6 At4g37560.1 68417.m05316 formamidase, putative / formamide amido... 27 8.3 At4g37550.1 68417.m05314 formamidase, putative / formamide amido... 27 8.3 At3g11900.1 68416.m01459 amino acid transporter family protein l... 27 8.3 >At1g77140.1 68414.m08986 vacuolar protein sorting protein 45, putative / VPS45p, putative identical to vacuolar protein sorting homolog VPS45p [Arabidopsis thaliana] gi|2921406|gb|AAC39472 Length = 569 Score = 70.5 bits (165), Expect = 7e-13 Identities = 31/74 (41%), Positives = 48/74 (64%) Frame = +3 Query: 255 HMKCXVFIRPTSENIALLSRELRDPKYGVYFIYFXNXVSKADIKTLAECDEXEAVRXVQE 434 H+K FIRPTS+NI L +L +P++G Y ++F N + I LA+ DE E V+ VQE Sbjct: 66 HLKAVYFIRPTSDNIQKLRYQLANPRFGEYHLFFSNLLKDTQIHILADSDEQEVVQQVQE 125 Query: 435 VFADYLAVDRHLFS 476 +AD+++ D + F+ Sbjct: 126 YYADFVSGDPYHFT 139 Score = 62.1 bits (144), Expect = 2e-10 Identities = 31/57 (54%), Positives = 43/57 (75%) Frame = +1 Query: 61 MNVIQAVKMYITKMXEXSGPGMKVILMDKETTSIVSMVYSQSEILQKEVYLFERIDS 231 M ++ +V+ YI +M + GMKV+++D ET S VS+VYSQSE+LQKEV+L E IDS Sbjct: 1 MVLVTSVRDYINRMLQDIS-GMKVLILDSETVSNVSIVYSQSELLQKEVFLVEMIDS 56 >At4g12120.1 68417.m01924 cytokinesis-related Sec1 protein, putative similar to cytokinesis-related Sec1 protein KEULE [Arabidopsis thaliana] gi|12659318|gb|AAK01291; contains Pfam domain, PF00995: Sec1 family Length = 662 Score = 31.9 bits (69), Expect = 0.29 Identities = 16/36 (44%), Positives = 21/36 (58%) Frame = +1 Query: 127 KVILMDKETTSIVSMVYSQSEILQKEVYLFERIDSH 234 KV++MDK T I+S SEI Q+ + L E I H Sbjct: 44 KVLVMDKFTVKIMSSACKMSEITQEGISLVEVITKH 79 >At1g12360.1 68414.m01428 cytokinesis-related Sec1 protein (KEULE) similar to cytokinesis-related Sec1 protein KEULE [Arabidopsis thaliana] gi|12659318|gb|AAK01291; contains Pfam domain, PF00995: Sec1 family Length = 666 Score = 31.9 bits (69), Expect = 0.29 Identities = 18/75 (24%), Positives = 37/75 (49%), Gaps = 3/75 (4%) Frame = +3 Query: 258 MKCXVFIRPTSENIALLSREL--RDPKYGVYFIYFXNXVSKADIKTL-AECDEXEAVRXV 428 M FI+PT EN+ + ++ + P Y F++F + VSK + + + + + Sbjct: 86 MDAIYFIQPTKENVIMFLSDMSGKSPLYKKAFVFFSSPVSKELVGHIKKDSSVLPRIGAL 145 Query: 429 QEVFADYLAVDRHLF 473 +E+ ++ A+D F Sbjct: 146 REMNLEFFAIDSQGF 160 >At3g15060.1 68416.m01905 Ras-related GTP-binding family protein similar to GTP-binding protein GI:303742 from [Pisum sativum]; contains Pfam profile: PF00071 ras family Length = 217 Score = 28.3 bits (60), Expect = 3.6 Identities = 15/44 (34%), Positives = 25/44 (56%) Frame = -1 Query: 473 EQVSVHXQVVSKNFLDLSDSLXFITFGQSFDVCLRNXITEIYKV 342 E +S +V SK LD+ D + GQS +V ++ ++E+ KV Sbjct: 169 EVLSQIYRVASKKALDIGDDHTTLPKGQSINVGSKDDVSEVKKV 212 >At4g37560.1 68417.m05316 formamidase, putative / formamide amidohydrolase, putative similar to SP|Q50228 Formamidase (EC 3.5.1.49) (Formamide amidohydrolase) {Methylophilus methylotrophus}; contains Pfam profile PF03069: Acetamidase/Formamidase family Length = 452 Score = 27.1 bits (57), Expect = 8.3 Identities = 12/34 (35%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Frame = -2 Query: 283 GRIKTXHFMCSCYPIWH-DCLSSRISKLPSVRFP 185 G T HF C+ IW+ + + + ++P VRFP Sbjct: 124 GGFLTDHFPCATKAIWYFEGIYAYSPQIPGVRFP 157 >At4g37550.1 68417.m05314 formamidase, putative / formamide amidohydrolase, putative similar to SP|Q50228 Formamidase (EC 3.5.1.49) (Formamide amidohydrolase) {Methylophilus methylotrophus}; contains Pfam profile PF03069: Acetamidase/Formamidase family Length = 452 Score = 27.1 bits (57), Expect = 8.3 Identities = 12/34 (35%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Frame = -2 Query: 283 GRIKTXHFMCSCYPIWH-DCLSSRISKLPSVRFP 185 G T HF C+ IW+ + + + ++P VRFP Sbjct: 124 GGFLTDHFPCATKAIWYFEGIYAYSPQIPGVRFP 157 >At3g11900.1 68416.m01459 amino acid transporter family protein low similarity to proton/amino acid transporter 1 [Mus musculus] GI:21908024; belongs to INTERPRO:IPR002422 amino acid/polyamine transporter, family II Length = 432 Score = 27.1 bits (57), Expect = 8.3 Identities = 15/41 (36%), Positives = 24/41 (58%) Frame = -1 Query: 179 LYTILTMLVVSLSINITFIPGPLSSXILVMYILTACITFIL 57 ++T T+LVV L+ + +PG + LV L A I+F+L Sbjct: 349 IFTTRTLLVVGLAAIASLVPGFGTFASLVGSTLCALISFVL 389 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,027,860 Number of Sequences: 28952 Number of extensions: 174506 Number of successful extensions: 337 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 333 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 337 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1033331880 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -