BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30768.Seq (698 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF068713-2|AAC17805.1| 347|Caenorhabditis elegans Seven tm rece... 29 3.2 U80845-1|AAK39181.1| 1217|Caenorhabditis elegans Prion-like-(q/n... 28 5.6 AC006780-3|AAF60649.2| 425|Caenorhabditis elegans Hypothetical ... 28 5.6 >AF068713-2|AAC17805.1| 347|Caenorhabditis elegans Seven tm receptor protein 260 protein. Length = 347 Score = 29.1 bits (62), Expect = 3.2 Identities = 18/60 (30%), Positives = 30/60 (50%), Gaps = 5/60 (8%) Frame = +2 Query: 101 FEWVSKRDAPAALFFNYQKKMESKYFMQTLNLTVKI--YRGVKGYHSLN---FEKNTQQK 265 F W + +FN++ + M ++L++ I Y GVKGY S+N + N+ QK Sbjct: 183 FFWPKYNNFTTDQYFNWRTAGGAMIVMGLISLSIAIMVYFGVKGYRSMNKLIAQSNSSQK 242 >U80845-1|AAK39181.1| 1217|Caenorhabditis elegans Prion-like-(q/n-rich)-domain-bearingprotein protein 15 protein. Length = 1217 Score = 28.3 bits (60), Expect = 5.6 Identities = 15/41 (36%), Positives = 22/41 (53%), Gaps = 2/41 (4%) Frame = +2 Query: 146 NYQKKMESKYFMQTLNLTVKIY--RGVKGYHSLNFEKNTQQ 262 N+ K + M + L KIY + GYHSLNF+++ Q Sbjct: 170 NFNKLRQYICIMNSQALKCKIYEHKEENGYHSLNFDESDHQ 210 >AC006780-3|AAF60649.2| 425|Caenorhabditis elegans Hypothetical protein Y47D9A.5 protein. Length = 425 Score = 28.3 bits (60), Expect = 5.6 Identities = 13/34 (38%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Frame = -3 Query: 477 GISIGCYCSVDRRSACCGS*LVYTQTY-LENVLS 379 GISI CYC+ +AC S ++ Y L+N ++ Sbjct: 87 GISINCYCAKSFFAACLSSTIIAESIYQLKNTIN 120 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,887,930 Number of Sequences: 27780 Number of extensions: 303615 Number of successful extensions: 635 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 628 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 635 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1613473434 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -