BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30762.Seq (748 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g28770.1 68416.m03591 expressed protein 31 0.81 At2g21440.1 68415.m02551 RNA recognition motif (RRM)-containing ... 29 2.5 At4g37820.1 68417.m05351 expressed protein Kaposi's sarcoma-asso... 29 4.3 At5g63530.1 68418.m07974 copper chaperone (CCH)-related low simi... 27 10.0 At5g54020.1 68418.m06719 expressed protein 27 10.0 At1g43970.1 68414.m05072 hypothetical protein 27 10.0 >At3g28770.1 68416.m03591 expressed protein Length = 2081 Score = 31.1 bits (67), Expect = 0.81 Identities = 19/53 (35%), Positives = 22/53 (41%), Gaps = 1/53 (1%) Frame = +3 Query: 222 EGAQKEDQRSRKENKG-KPEPKPAKGVTVPTRKGIKETQNVKSQDXXSGEQQK 377 E Q + S K KG K E K AK V K + T+N SGE K Sbjct: 773 ENVQGNKKESEKVEKGEKKESKDAKSVETKDNKKLSSTENRDEAKERSGEDNK 825 >At2g21440.1 68415.m02551 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 1003 Score = 29.5 bits (63), Expect = 2.5 Identities = 20/83 (24%), Positives = 43/83 (51%), Gaps = 3/83 (3%) Frame = +3 Query: 147 SSEQIRSFLGR*DRSS*CVKSARAGE--GAQKEDQRSR-KENKGKPEPKPAKGVTVPTRK 317 S E+ +S + D ++ + R E + K+ Q R KE KP+PK +K ++ P ++ Sbjct: 877 SKEEAKSNIAVKDNAAEKKRPIRTQEKPSSNKKGQLMRQKETTEKPDPKISKDLSEPRKR 936 Query: 318 GIKETQNVKSQDXXSGEQQKGKG 386 E + ++++ +++G+G Sbjct: 937 KFGEDRGEENRNGQRKRKKQGQG 959 >At4g37820.1 68417.m05351 expressed protein Kaposi's sarcoma-associated herpes-like virus ORF73gene, Kaposi's sarcoma-associated herpesvirus, U52064 Length = 532 Score = 28.7 bits (61), Expect = 4.3 Identities = 17/55 (30%), Positives = 29/55 (52%), Gaps = 1/55 (1%) Frame = +3 Query: 222 EGAQKEDQRSRKENKGK-PEPKPAKGVTVPTRKGIKETQNVKSQDXXSGEQQKGK 383 E +KED S++E+K + PE K + + IKET+ + ++ S E + K Sbjct: 354 EKREKEDSSSQEESKEEEPENKEKEASSSQEENEIKETEIKEKEESSSQEGNENK 408 >At5g63530.1 68418.m07974 copper chaperone (CCH)-related low similarity to copper homeostasis factor [GI:3168840]; nearly identical to farnesylated protein ATFP3 [GI:4097547]; contains Pfam profile PF00403: Heavy-metal-associated domain Length = 355 Score = 27.5 bits (58), Expect = 10.0 Identities = 18/58 (31%), Positives = 31/58 (53%), Gaps = 1/58 (1%) Frame = +3 Query: 204 KSARAGEGAQKEDQRSRKENKGKPEPKPAKGVTVPTRK-GIKETQNVKSQDXXSGEQQ 374 ++A A EG +KE+++ E+KG+ E K K T +K G ++ D GE++ Sbjct: 248 EAAAAAEGEKKEEEKGEGESKGE-EGKDDKAKTDEEKKEGDGGKGEGEAADNGGGEEE 304 >At5g54020.1 68418.m06719 expressed protein Length = 556 Score = 27.5 bits (58), Expect = 10.0 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = +2 Query: 41 DKMSPY*CAESNPITSKYCVIKSSR 115 D +PY C E N + KYC+ K R Sbjct: 154 DDRNPYVCLECNLMVHKYCIEKLPR 178 >At1g43970.1 68414.m05072 hypothetical protein Length = 239 Score = 27.5 bits (58), Expect = 10.0 Identities = 14/45 (31%), Positives = 21/45 (46%) Frame = +3 Query: 252 RKENKGKPEPKPAKGVTVPTRKGIKETQNVKSQDXXSGEQQKGKG 386 R P GV+ T + K ++ S++ S +QQKGKG Sbjct: 67 RNRQNSVPMSTEVPGVSSVTSRLAKRKRDTPSEEFLSQKQQKGKG 111 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,567,134 Number of Sequences: 28952 Number of extensions: 200143 Number of successful extensions: 492 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 481 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 492 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1653386488 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -