BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30759.Seq (501 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_35685| Best HMM Match : Ribosomal_S8 (HMM E-Value=0.08) 73 2e-13 SB_23248| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 4e-06 SB_54474| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.0 >SB_35685| Best HMM Match : Ribosomal_S8 (HMM E-Value=0.08) Length = 120 Score = 72.5 bits (170), Expect = 2e-13 Identities = 37/43 (86%), Positives = 39/43 (90%) Frame = +3 Query: 69 MVRMNVLSDALKSIHNAEKRGKRQVLIRPCSKVIVKFLTVMMK 197 MVR+NVL+DAL SI NAEKRGKRQV IRP SKVIVKFLTVMMK Sbjct: 1 MVRVNVLNDALVSICNAEKRGKRQVQIRPSSKVIVKFLTVMMK 43 >SB_23248| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 29 Score = 48.0 bits (109), Expect = 4e-06 Identities = 21/28 (75%), Positives = 24/28 (85%), Gaps = 1/28 (3%) Frame = +2 Query: 281 CGVXSPRFDVPINDIERW-TNLLPSRQF 361 CGV SPRFDV + DIE+W +NLLPSRQF Sbjct: 1 CGVISPRFDVGVRDIEQWASNLLPSRQF 28 >SB_54474| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 60 Score = 27.9 bits (59), Expect = 5.0 Identities = 16/44 (36%), Positives = 24/44 (54%), Gaps = 2/44 (4%) Frame = +3 Query: 102 KSIHNAEKRGKRQVLIRPCSKVIVKFL--TVMMKXGYIGEFEIV 227 K+IHN RGKR +++ V F TV+M+ G F++V Sbjct: 17 KNIHNVNVRGKRGNIVQVYPAVEYDFTPNTVLMRNGDYVHFQLV 60 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,649,831 Number of Sequences: 59808 Number of extensions: 224277 Number of successful extensions: 377 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 363 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 376 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1087245449 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -