BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30759.Seq (501 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF025460-6|AAB70989.1| 130|Caenorhabditis elegans Ribosomal pro... 109 1e-24 Z81066-3|CAI46608.1| 363|Caenorhabditis elegans Hypothetical pr... 27 5.8 U41542-2|AAR30212.1| 623|Caenorhabditis elegans Suppressor of p... 27 7.6 U41542-1|AAR30211.1| 684|Caenorhabditis elegans Suppressor of p... 27 7.6 >AF025460-6|AAB70989.1| 130|Caenorhabditis elegans Ribosomal protein, small subunitprotein 22 protein. Length = 130 Score = 109 bits (262), Expect = 1e-24 Identities = 50/68 (73%), Positives = 58/68 (85%), Gaps = 1/68 (1%) Frame = +2 Query: 254 LNLXGXLNKCGVXSPRFDVPINDIERWTN-LLPSRQFGYLVLTTSGGIMDHEEARRKHLG 430 +NL G LNK V SPR ++ +ND+E++TN LLPSRQFGYL+LTTS GIMDHEEARRKHLG Sbjct: 63 VNLTGRLNKASVISPRLNIRLNDLEKYTNTLLPSRQFGYLILTTSAGIMDHEEARRKHLG 122 Query: 431 GKILGFLF 454 GKILGF F Sbjct: 123 GKILGFFF 130 Score = 106 bits (255), Expect = 8e-24 Identities = 52/62 (83%), Positives = 56/62 (90%) Frame = +3 Query: 69 MVRMNVLSDALKSIHNAEKRGKRQVLIRPCSKVIVKFLTVMMKXGYIGEFEIVDDXRXGX 248 MVRMNVL+DAL +I+NAEKRGKRQVLIRP SKVIV+FLTVMMK GYIGEFEIVDD R G Sbjct: 1 MVRMNVLADALNAINNAEKRGKRQVLIRPASKVIVRFLTVMMKHGYIGEFEIVDDHRAGK 60 Query: 249 IV 254 IV Sbjct: 61 IV 62 >Z81066-3|CAI46608.1| 363|Caenorhabditis elegans Hypothetical protein F17B5.6 protein. Length = 363 Score = 27.5 bits (58), Expect = 5.8 Identities = 9/14 (64%), Positives = 10/14 (71%), Gaps = 1/14 (7%) Frame = +1 Query: 352 TTVWL-PSPYNKWW 390 T +WL P PYN WW Sbjct: 29 TVIWLIPRPYNYWW 42 >U41542-2|AAR30212.1| 623|Caenorhabditis elegans Suppressor of presenilin defectprotein 3, isoform b protein. Length = 623 Score = 27.1 bits (57), Expect = 7.6 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = -1 Query: 78 YAPWLRFSSRFVANRIDRTVQKKKK 4 +A WLR+ R N +++ KKKK Sbjct: 323 FATWLRYERRINKNDLNKPTNKKKK 347 >U41542-1|AAR30211.1| 684|Caenorhabditis elegans Suppressor of presenilin defectprotein 3, isoform a protein. Length = 684 Score = 27.1 bits (57), Expect = 7.6 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = -1 Query: 78 YAPWLRFSSRFVANRIDRTVQKKKK 4 +A WLR+ R N +++ KKKK Sbjct: 323 FATWLRYERRINKNDLNKPTNKKKK 347 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,590,688 Number of Sequences: 27780 Number of extensions: 166881 Number of successful extensions: 327 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 322 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 326 length of database: 12,740,198 effective HSP length: 76 effective length of database: 10,628,918 effective search space used: 956602620 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -