BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30752.Seq (399 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g06680.1 68416.m00788 60S ribosomal protein L29 (RPL29B) simi... 60 5e-10 At3g06700.1 68416.m00792 60S ribosomal protein L29 (RPL29A) simi... 59 9e-10 At4g10220.1 68417.m01676 hypothetical protein IB1C3-1 protein, A... 27 4.6 At1g14350.1 68414.m01701 myb family transcription factor (MYB124... 27 4.6 At4g01925.1 68417.m00256 DC1 domain-containing protein low simil... 26 8.0 At3g13760.1 68416.m01736 DC1 domain-containing protein contains ... 26 8.0 At1g62720.1 68414.m07079 pentatricopeptide (PPR) repeat-containi... 26 8.0 >At3g06680.1 68416.m00788 60S ribosomal protein L29 (RPL29B) similar to 60S ribosomal protein L29 GB:P25886 from (Rattus norvegicus) Length = 83 Score = 60.1 bits (139), Expect = 5e-10 Identities = 28/58 (48%), Positives = 35/58 (60%) Frame = +3 Query: 162 KMAKSKNHTNHNQNRKAHRNGIKKPRKTRHEPPLAWIQNF*GIXGFARRXTXSQPSNS 335 +MAKSKNHT HNQ+ KAH+NGIKKPR+ RH P F +AR+ N+ Sbjct: 22 EMAKSKNHTAHNQSAKAHKNGIKKPRRHRHTPTRGMDPKFLRNQRYARKHNVKSGENA 79 >At3g06700.1 68416.m00792 60S ribosomal protein L29 (RPL29A) similar to ribosomal protein L29 GI:7959366 [Panax ginseng] Length = 61 Score = 59.3 bits (137), Expect = 9e-10 Identities = 28/57 (49%), Positives = 34/57 (59%) Frame = +3 Query: 165 MAKSKNHTNHNQNRKAHRNGIKKPRKTRHEPPLAWIQNF*GIXGFARRXTXSQPSNS 335 MAKSKNHT HNQ+ KAH+NGIKKPR+ RH P F +AR+ N+ Sbjct: 1 MAKSKNHTAHNQSAKAHKNGIKKPRRHRHTPTRGMDPKFLRNQRYARKHNVKAGENA 57 >At4g10220.1 68417.m01676 hypothetical protein IB1C3-1 protein, Arabidopsis thaliana, AJ011845 Length = 400 Score = 27.1 bits (57), Expect = 4.6 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = +3 Query: 177 KNHTNHNQNRKAHRNGIKKPRKT 245 KNHT H++ R ++ G K RKT Sbjct: 88 KNHTFHHKMRMSYSEGSKMKRKT 110 >At1g14350.1 68414.m01701 myb family transcription factor (MYB124) contains PFAM profile: PF00249 myb-like DNA binding domain Length = 436 Score = 27.1 bits (57), Expect = 4.6 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = +3 Query: 186 TNHNQNRKAHRNGIKKPRKTRHEPPLA 266 +N N R +GI PRK+ +E P+A Sbjct: 135 SNSNTKRMLFLDGISTPRKSENETPIA 161 >At4g01925.1 68417.m00256 DC1 domain-containing protein low similarity to UV-B light insensitive ULI3 [Arabidopsis thaliana] GI:17225050; contains Pfam profile PF03107: DC1 domain Length = 399 Score = 26.2 bits (55), Expect = 8.0 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = -1 Query: 225 YHFCELCGFGYDLYDSLTLP 166 YH CE CGF DLY ++ P Sbjct: 65 YH-CETCGFDVDLYCAMYPP 83 >At3g13760.1 68416.m01736 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 652 Score = 26.2 bits (55), Expect = 8.0 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = -1 Query: 225 YHFCELCGFGYDLYDSLTLPF**VFNP 145 ++ C +CGF DL +LTLP + NP Sbjct: 182 FYRCLICGFCLDLSCALTLPPLTIANP 208 >At1g62720.1 68414.m07079 pentatricopeptide (PPR) repeat-containing protein contains multiple PPR repeats Pfam Profile: PF01535 Length = 426 Score = 26.2 bits (55), Expect = 8.0 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = -1 Query: 225 YHFCELCGFGYDLY 184 +H E+CG G+DLY Sbjct: 33 FHHMEVCGIGHDLY 46 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,177,867 Number of Sequences: 28952 Number of extensions: 95758 Number of successful extensions: 252 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 249 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 250 length of database: 12,070,560 effective HSP length: 74 effective length of database: 9,928,112 effective search space used: 575830496 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -