BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30751.Seq (548 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_3347| Best HMM Match : WD40 (HMM E-Value=0.053) 58 4e-09 SB_36694| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.20 SB_26375| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.62 SB_40766| Best HMM Match : WD40 (HMM E-Value=1.19993e-41) 30 1.1 SB_49036| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_43403| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_5618| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.9 SB_19258| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.9 SB_5842| Best HMM Match : WD40 (HMM E-Value=6.7e-21) 29 2.5 SB_19094| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 SB_42598| Best HMM Match : CtaG_Cox11 (HMM E-Value=0) 29 3.3 SB_27472| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.3 SB_47598| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.4 SB_21111| Best HMM Match : WD40 (HMM E-Value=0.0047) 28 5.8 SB_48711| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.6 SB_15464| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.6 >SB_3347| Best HMM Match : WD40 (HMM E-Value=0.053) Length = 321 Score = 58.4 bits (135), Expect = 4e-09 Identities = 22/53 (41%), Positives = 34/53 (64%) Frame = +2 Query: 14 FSEDGKYYSTITKDGRLKIWDTETNVLKQEYTPDLHLTSPPTCLQWTTVSQSV 172 F +G++ + +T DGRLK+WD LK +YTP HL++ CL+W S++V Sbjct: 10 FDNNGRFLALLTPDGRLKVWDCTNGSLKNQYTPSSHLSTTCACLKWCNSSRNV 62 Score = 32.3 bits (70), Expect = 0.27 Identities = 14/36 (38%), Positives = 20/36 (55%) Frame = +1 Query: 325 SAKVTALDWSRKYGLYSCTKDSRVYEXXIEDGSVKQ 432 S+KV ++WSR LYSC+ D + E E K+ Sbjct: 67 SSKVNDVEWSRNGELYSCSSDKYIVEWCTEKAEHKR 102 >SB_36694| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1803 Score = 32.7 bits (71), Expect = 0.20 Identities = 16/53 (30%), Positives = 25/53 (47%) Frame = +2 Query: 14 FSEDGKYYSTITKDGRLKIWDTETNVLKQEYTPDLHLTSPPTCLQWTTVSQSV 172 FS++GK ++ D +LK+WD E+ L T P C W V ++ Sbjct: 1272 FSKNGKRLVSVALDKKLKVWDVESGNLLDTLTGH---DGYPVCCAWNPVDNTM 1321 >SB_26375| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 297 Score = 31.1 bits (67), Expect = 0.62 Identities = 11/35 (31%), Positives = 20/35 (57%) Frame = +2 Query: 5 EAMFSEDGKYYSTITKDGRLKIWDTETNVLKQEYT 109 + FSED +Y T + D ++W+ E + +EY+ Sbjct: 246 DCAFSEDSQYLVTASSDNLARLWNVEAGEVVREYS 280 >SB_40766| Best HMM Match : WD40 (HMM E-Value=1.19993e-41) Length = 1487 Score = 30.3 bits (65), Expect = 1.1 Identities = 11/24 (45%), Positives = 17/24 (70%) Frame = +2 Query: 14 FSEDGKYYSTITKDGRLKIWDTET 85 +S DG Y +T DG++K+W+T T Sbjct: 1259 YSPDGNYIATGGDDGKVKLWNTMT 1282 >SB_49036| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 696 Score = 29.9 bits (64), Expect = 1.4 Identities = 16/53 (30%), Positives = 28/53 (52%), Gaps = 5/53 (9%) Frame = +1 Query: 304 WVPAK--HFSAKVTALDWS---RKYGLYSCTKDSRVYEXXIEDGSVKQTYNIS 447 W P++ +S+KV +L WS +Y L++C D I S QT++++ Sbjct: 301 WKPSEVQAYSSKVLSLLWSLGQHQYNLFTCGPDGNTMWWRIRPDSTDQTFHLA 353 >SB_43403| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 539 Score = 29.9 bits (64), Expect = 1.4 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = +2 Query: 14 FSEDGKYYSTITKDGRLKIWDTETNVLKQEYT 109 FS +GKY T D LK+WD + YT Sbjct: 130 FSPNGKYILAATLDNTLKLWDYSKGKCLKTYT 161 >SB_5618| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 801 Score = 29.5 bits (63), Expect = 1.9 Identities = 11/32 (34%), Positives = 21/32 (65%) Frame = +2 Query: 8 AMFSEDGKYYSTITKDGRLKIWDTETNVLKQE 103 A FS DG+Y T + DG +++W+ T ++++ Sbjct: 220 AAFSPDGQYLVTGSVDGFIEVWNFTTGKIRKD 251 >SB_19258| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 459 Score = 29.5 bits (63), Expect = 1.9 Identities = 12/31 (38%), Positives = 19/31 (61%) Frame = +2 Query: 14 FSEDGKYYSTITKDGRLKIWDTETNVLKQEY 106 FS DG+Y ++ + D R+ IW T+T L + Sbjct: 341 FSPDGRYLASGSFDKRVHIWSTQTGNLVHSF 371 >SB_5842| Best HMM Match : WD40 (HMM E-Value=6.7e-21) Length = 759 Score = 29.1 bits (62), Expect = 2.5 Identities = 12/35 (34%), Positives = 18/35 (51%) Frame = +2 Query: 5 EAMFSEDGKYYSTITKDGRLKIWDTETNVLKQEYT 109 + F+ DG + + D +K+WDTET YT Sbjct: 138 DVSFNNDGTQFLSAGYDRYVKLWDTETGECLGRYT 172 >SB_19094| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 362 Score = 29.1 bits (62), Expect = 2.5 Identities = 11/46 (23%), Positives = 21/46 (45%) Frame = +2 Query: 35 YSTITKDGRLKIWDTETNVLKQEYTPDLHLTSPPTCLQWTTVSQSV 172 + + ++DG + +WDT + S P CL W+ + S+ Sbjct: 145 FLSASRDGSVVLWDTRKPRPAKRLADPTQYDSIPCCLDWSPLDSSI 190 >SB_42598| Best HMM Match : CtaG_Cox11 (HMM E-Value=0) Length = 1498 Score = 28.7 bits (61), Expect = 3.3 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = +2 Query: 23 DGKYYSTITKDGRLKIWDTE 82 D KY++T KDG L +W T+ Sbjct: 779 DDKYFATCAKDGVLHLWTTD 798 >SB_27472| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 38 Score = 28.7 bits (61), Expect = 3.3 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = +2 Query: 14 FSEDGKYYSTITKDGRLKIWDTETNVL 94 FS DG Y + DG+L IWD ++ L Sbjct: 10 FSPDGSYVISGDADGKLNIWDWKSTKL 36 >SB_47598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2332 Score = 28.3 bits (60), Expect = 4.4 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = +2 Query: 11 MFSEDGKYYSTITKDGRLKIWDTETNV 91 +F KY T +DG +K+WD NV Sbjct: 191 LFFNPLKYLITAARDGSIKVWDDTGNV 217 >SB_21111| Best HMM Match : WD40 (HMM E-Value=0.0047) Length = 96 Score = 27.9 bits (59), Expect = 5.8 Identities = 9/22 (40%), Positives = 16/22 (72%) Frame = +2 Query: 17 SEDGKYYSTITKDGRLKIWDTE 82 S+D Y++T + DG +K+WD + Sbjct: 56 SQDLMYFATASDDGTVKLWDLQ 77 >SB_48711| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 299 Score = 27.5 bits (58), Expect = 7.6 Identities = 10/22 (45%), Positives = 16/22 (72%) Frame = +2 Query: 23 DGKYYSTITKDGRLKIWDTETN 88 DGKY ++ KD ++IWD +T+ Sbjct: 125 DGKYLASGGKDKLIRIWDPDTS 146 >SB_15464| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1042 Score = 27.5 bits (58), Expect = 7.6 Identities = 15/51 (29%), Positives = 22/51 (43%) Frame = -3 Query: 354 TPIQGGHFSAKMFGGHPNIYYFRLTY*VY*QFTIVVPNTMHWDSFSFVLAF 202 T IQ HFS + + F Y Q+ + +PN M W ++ F F Sbjct: 706 TVIQVMHFSVMLMTAFMCLREFMQMYNNRLQYFLYMPNYMEWTAYIFTFLF 756 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,139,183 Number of Sequences: 59808 Number of extensions: 304392 Number of successful extensions: 744 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 694 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 744 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1264269032 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -