BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30746.Seq (440 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value Z26319-1|CAA81228.1| 464|Apis mellifera royal jelly protein RJP... 24 0.85 AB208108-1|BAE72140.1| 92|Apis mellifera Broad complex zinc fi... 21 7.9 >Z26319-1|CAA81228.1| 464|Apis mellifera royal jelly protein RJP57-2 protein. Length = 464 Score = 23.8 bits (49), Expect = 0.85 Identities = 8/27 (29%), Positives = 12/27 (44%) Frame = +3 Query: 174 KSKNHTNHNQNRKAHRNGIKKPRKTRH 254 + NH NHN N+ H + +H Sbjct: 420 QDNNHYNHNHNQARHSSKSDNQNNNQH 446 >AB208108-1|BAE72140.1| 92|Apis mellifera Broad complex zinc finger domain-Z3 isoform protein. Length = 92 Score = 20.6 bits (41), Expect = 7.9 Identities = 11/35 (31%), Positives = 15/35 (42%) Frame = -3 Query: 225 HFCELCGFGYDLYDSLTLPF*WSFQSCKGKIKSLL 121 + CE C Y +SLT + G +K LL Sbjct: 36 YVCEFCNRRYRTKNSLTTHKSLQHRGSSGMLKRLL 70 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 87,738 Number of Sequences: 438 Number of extensions: 1514 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 11450997 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -