BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30745.Seq (698 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc fin... 27 0.11 AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory recept... 23 2.4 >AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc finger protein protein. Length = 456 Score = 27.5 bits (58), Expect = 0.11 Identities = 12/31 (38%), Positives = 15/31 (48%), Gaps = 2/31 (6%) Frame = +1 Query: 409 Y*NTSYHLIYLTWHGTST--VCEWCWCGMEF 495 Y TS+ +L WH VC W +CG F Sbjct: 326 YGKTSHLKAHLRWHTGERPFVCNWLFCGKRF 356 >AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory receptor candidate 61 protein. Length = 670 Score = 23.0 bits (47), Expect = 2.4 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = +1 Query: 100 CLIRFTPIVFDSIFQYHKNYM 162 CLI+F IVF + Y+ + M Sbjct: 261 CLIQFNTIVFSFCYCYYNSKM 281 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 148,316 Number of Sequences: 336 Number of extensions: 2938 Number of successful extensions: 9 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18426585 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -