BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30738.Seq (748 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF387862-1|AAL56547.1| 476|Anopheles gambiae gag polyprotein pr... 29 0.20 AY578799-1|AAT07304.1| 679|Anopheles gambiae brinker protein. 25 2.5 AY553322-1|AAT36323.1| 426|Anopheles gambiae G-protein coupled ... 24 5.7 Y17704-1|CAA76824.2| 401|Anopheles gambiae hypothetical protein... 23 7.6 DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methopren... 23 7.6 AF513634-1|AAM53606.1| 216|Anopheles gambiae glutathione S-tran... 23 7.6 >AF387862-1|AAL56547.1| 476|Anopheles gambiae gag polyprotein protein. Length = 476 Score = 28.7 bits (61), Expect = 0.20 Identities = 17/52 (32%), Positives = 27/52 (51%) Frame = +3 Query: 552 KNHGKEGTIVVTKVEEPSKYGVVVYDDNGQIESFIEKPQEFISNKINXGMYL 707 K+H K T + TKV K YD++G +E+ + + E S+ +N G L Sbjct: 86 KHHQK--TTMSTKVSLLKKLCKAEYDESGDMEAHLFRMDELFSSLMNAGQEL 135 >AY578799-1|AAT07304.1| 679|Anopheles gambiae brinker protein. Length = 679 Score = 25.0 bits (52), Expect = 2.5 Identities = 7/10 (70%), Positives = 9/10 (90%) Frame = -2 Query: 639 DHYHHKQPHH 610 DH+HH+Q HH Sbjct: 650 DHHHHQQHHH 659 Score = 23.4 bits (48), Expect = 7.6 Identities = 6/9 (66%), Positives = 7/9 (77%) Frame = -2 Query: 636 HYHHKQPHH 610 H+HH PHH Sbjct: 157 HHHHHHPHH 165 >AY553322-1|AAT36323.1| 426|Anopheles gambiae G-protein coupled receptor 4 protein. Length = 426 Score = 23.8 bits (49), Expect = 5.7 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = -3 Query: 233 SKVLNEFRSRRPRSGPVSLLISY 165 S V+ FRSRR R VSL+I + Sbjct: 96 SVVITLFRSRRHRRSRVSLMICH 118 >Y17704-1|CAA76824.2| 401|Anopheles gambiae hypothetical protein protein. Length = 401 Score = 23.4 bits (48), Expect = 7.6 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = +2 Query: 407 HFLMRLNHWEQQDH 448 +FL RLNHW DH Sbjct: 80 NFLFRLNHW-HDDH 92 >DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methoprene-tolerant protein protein. Length = 1115 Score = 23.4 bits (48), Expect = 7.6 Identities = 6/9 (66%), Positives = 7/9 (77%) Frame = -2 Query: 636 HYHHKQPHH 610 H+HH PHH Sbjct: 186 HHHHHHPHH 194 >AF513634-1|AAM53606.1| 216|Anopheles gambiae glutathione S-transferase D5 protein. Length = 216 Score = 23.4 bits (48), Expect = 7.6 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = -2 Query: 492 EWFRTGAEQFPGKCQW 445 EWFR E++PG W Sbjct: 166 EWFRYDLERYPGIRGW 181 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 725,622 Number of Sequences: 2352 Number of extensions: 14203 Number of successful extensions: 70 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 67 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 70 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 76923555 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -