BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30729.Seq (548 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY769960-1|AAV34676.1| 603|Apis mellifera soluble guanylyl cycl... 22 3.6 AB181489-1|BAD22772.1| 603|Apis mellifera soluble guanylyl cycl... 22 3.6 DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monoo... 21 6.2 AF514804-1|AAM51823.1| 537|Apis mellifera neuronal nicotinic ac... 21 6.2 AF144379-1|AAD34586.1| 543|Apis mellifera glutamate transporter... 21 8.2 >AY769960-1|AAV34676.1| 603|Apis mellifera soluble guanylyl cyclase beta 1 subunit protein. Length = 603 Score = 22.2 bits (45), Expect = 3.6 Identities = 10/37 (27%), Positives = 18/37 (48%) Frame = +1 Query: 433 KFLLTTWLWTDTCSLSILLDASXVGLEPTASPTSFSR 543 +FL+T S ++ + + +EP SP +F R Sbjct: 177 QFLITNTSGPGVVSNPMIAELETLSVEPKVSPMTFCR 213 >AB181489-1|BAD22772.1| 603|Apis mellifera soluble guanylyl cyclase beta 1 subunit protein. Length = 603 Score = 22.2 bits (45), Expect = 3.6 Identities = 10/37 (27%), Positives = 18/37 (48%) Frame = +1 Query: 433 KFLLTTWLWTDTCSLSILLDASXVGLEPTASPTSFSR 543 +FL+T S ++ + + +EP SP +F R Sbjct: 177 QFLITNTSGPGVVSNPMIAELETLSVEPKVSPMTFCR 213 >DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monooxygenase protein. Length = 548 Score = 21.4 bits (43), Expect = 6.2 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = -1 Query: 503 TXEASNNIEREQVSVHSQVVSKNFLDLSD 417 T +NNI E VS V K+ LD+ D Sbjct: 281 TESKTNNIVVEGVSFGQSVGLKDDLDIDD 309 >AF514804-1|AAM51823.1| 537|Apis mellifera neuronal nicotinic acetylcholine receptoralpha-3 protein. Length = 537 Score = 21.4 bits (43), Expect = 6.2 Identities = 9/16 (56%), Positives = 13/16 (81%) Frame = -1 Query: 176 YTILTMLVVSLSINIT 129 Y + TM++V+LSI IT Sbjct: 315 YLLFTMILVTLSIWIT 330 >AF144379-1|AAD34586.1| 543|Apis mellifera glutamate transporter Am-EAAT protein. Length = 543 Score = 21.0 bits (42), Expect = 8.2 Identities = 9/29 (31%), Positives = 16/29 (55%) Frame = -1 Query: 143 SINITFIPGPLSXXILVMYILTACITFIL 57 SI + PG L +L M+IL ++ ++ Sbjct: 92 SITLISFPGELLMRLLKMFILPLIVSSLI 120 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 150,310 Number of Sequences: 438 Number of extensions: 2999 Number of successful extensions: 7 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 15704448 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -