BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30729.Seq (548 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g77140.1 68414.m08986 vacuolar protein sorting protein 45, pu... 77 1e-14 At4g12120.1 68417.m01924 cytokinesis-related Sec1 protein, putat... 36 0.024 At1g12360.1 68414.m01428 cytokinesis-related Sec1 protein (KEULE... 36 0.024 At3g15060.1 68416.m01905 Ras-related GTP-binding family protein ... 29 2.0 At3g11900.1 68416.m01459 amino acid transporter family protein l... 27 6.2 >At1g77140.1 68414.m08986 vacuolar protein sorting protein 45, putative / VPS45p, putative identical to vacuolar protein sorting homolog VPS45p [Arabidopsis thaliana] gi|2921406|gb|AAC39472 Length = 569 Score = 76.6 bits (180), Expect = 1e-14 Identities = 32/77 (41%), Positives = 53/77 (68%) Frame = +3 Query: 255 HMKCIVFIRPTSENIALLSRELRDPKYGVYFIYFSNVVSKADIKTLAECDEXXAVREVQE 434 H+K + FIRPTS+NI L +L +P++G Y ++FSN++ I LA+ DE V++VQE Sbjct: 66 HLKAVYFIRPTSDNIQKLRYQLANPRFGEYHLFFSNLLKDTQIHILADSDEQEVVQQVQE 125 Query: 435 VFADYLAVDRHLFSFNI 485 +AD+++ D + F+ N+ Sbjct: 126 YYADFVSGDPYHFTLNM 142 Score = 60.9 bits (141), Expect = 5e-10 Identities = 31/57 (54%), Positives = 42/57 (73%) Frame = +1 Query: 61 MNVIQAVKMYITKMXXXSGPGMKVILMDKETTSIVSMVYSQSEILQKEVYLFERIDS 231 M ++ +V+ YI +M GMKV+++D ET S VS+VYSQSE+LQKEV+L E IDS Sbjct: 1 MVLVTSVRDYINRMLQDIS-GMKVLILDSETVSNVSIVYSQSELLQKEVFLVEMIDS 56 >At4g12120.1 68417.m01924 cytokinesis-related Sec1 protein, putative similar to cytokinesis-related Sec1 protein KEULE [Arabidopsis thaliana] gi|12659318|gb|AAK01291; contains Pfam domain, PF00995: Sec1 family Length = 662 Score = 35.5 bits (78), Expect = 0.024 Identities = 20/78 (25%), Positives = 42/78 (53%), Gaps = 3/78 (3%) Frame = +3 Query: 258 MKCIVFIRPTSENIALLSREL--RDPKYGVYFIYFSNVVSKADIKTL-AECDEXXAVREV 428 M+ I FI+PT EN+ ++ + P Y F++FS+ VS++ + + + + + Sbjct: 86 MEVIYFIQPTEENVTAFLSDMTGKSPLYKKAFVFFSSPVSRSLVNLIKKDMRAMKRIGGL 145 Query: 429 QEVFADYLAVDRHLFSFN 482 +E+ +Y+++D F N Sbjct: 146 KEMNLEYISMDIQGFVTN 163 Score = 31.9 bits (69), Expect = 0.29 Identities = 16/36 (44%), Positives = 21/36 (58%) Frame = +1 Query: 127 KVILMDKETTSIVSMVYSQSEILQKEVYLFERIDSH 234 KV++MDK T I+S SEI Q+ + L E I H Sbjct: 44 KVLVMDKFTVKIMSSACKMSEITQEGISLVEVITKH 79 >At1g12360.1 68414.m01428 cytokinesis-related Sec1 protein (KEULE) similar to cytokinesis-related Sec1 protein KEULE [Arabidopsis thaliana] gi|12659318|gb|AAK01291; contains Pfam domain, PF00995: Sec1 family Length = 666 Score = 35.5 bits (78), Expect = 0.024 Identities = 20/75 (26%), Positives = 39/75 (52%), Gaps = 3/75 (4%) Frame = +3 Query: 258 MKCIVFIRPTSENIALLSREL--RDPKYGVYFIYFSNVVSKADIKTL-AECDEXXAVREV 428 M I FI+PT EN+ + ++ + P Y F++FS+ VSK + + + + + Sbjct: 86 MDAIYFIQPTKENVIMFLSDMSGKSPLYKKAFVFFSSPVSKELVGHIKKDSSVLPRIGAL 145 Query: 429 QEVFADYLAVDRHLF 473 +E+ ++ A+D F Sbjct: 146 REMNLEFFAIDSQGF 160 >At3g15060.1 68416.m01905 Ras-related GTP-binding family protein similar to GTP-binding protein GI:303742 from [Pisum sativum]; contains Pfam profile: PF00071 ras family Length = 217 Score = 29.1 bits (62), Expect = 2.0 Identities = 18/51 (35%), Positives = 27/51 (52%), Gaps = 3/51 (5%) Frame = -1 Query: 485 NIEREQVSVHSQ---VVSKNFLDLSDSXXFITFGQSFDVCLRNYITEIYKV 342 N+E V SQ V SK LD+ D + GQS +V ++ ++E+ KV Sbjct: 162 NVENAFTEVLSQIYRVASKKALDIGDDHTTLPKGQSINVGSKDDVSEVKKV 212 >At3g11900.1 68416.m01459 amino acid transporter family protein low similarity to proton/amino acid transporter 1 [Mus musculus] GI:21908024; belongs to INTERPRO:IPR002422 amino acid/polyamine transporter, family II Length = 432 Score = 27.5 bits (58), Expect = 6.2 Identities = 15/41 (36%), Positives = 24/41 (58%) Frame = -1 Query: 179 LYTILTMLVVSLSINITFIPGPLSXXILVMYILTACITFIL 57 ++T T+LVV L+ + +PG + LV L A I+F+L Sbjct: 349 IFTTRTLLVVGLAAIASLVPGFGTFASLVGSTLCALISFVL 389 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,221,811 Number of Sequences: 28952 Number of extensions: 208234 Number of successful extensions: 470 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 463 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 469 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1033331880 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -