BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30724.Seq (748 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_28342| Best HMM Match : HAT (HMM E-Value=0.043) 31 0.75 SB_20583| Best HMM Match : RCC1 (HMM E-Value=6.2e-08) 31 0.99 SB_14941| Best HMM Match : SH3_1 (HMM E-Value=1.1e-12) 30 2.3 SB_59432| Best HMM Match : MORN (HMM E-Value=9.3e-26) 29 3.0 SB_46796| Best HMM Match : RCC1 (HMM E-Value=3e-14) 28 7.0 SB_17995| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.0 SB_37873| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.2 SB_10740| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.2 SB_28088| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.2 >SB_28342| Best HMM Match : HAT (HMM E-Value=0.043) Length = 758 Score = 31.5 bits (68), Expect = 0.75 Identities = 19/47 (40%), Positives = 28/47 (59%) Frame = +3 Query: 606 SHNNPDRQRRCLYIR*QCHMVSAVGK*MSMKSIKVVWVTXNIPKLGK 746 S NN D++ R L R + + +A + MKSIK+ WV NIP++ K Sbjct: 423 SENNEDQRARKLLQRARMNACTAR---VMMKSIKLEWVLGNIPEVKK 466 >SB_20583| Best HMM Match : RCC1 (HMM E-Value=6.2e-08) Length = 970 Score = 31.1 bits (67), Expect = 0.99 Identities = 14/26 (53%), Positives = 17/26 (65%) Frame = +1 Query: 580 IKAVAAGRAHTIILTDKEGVYTLGNN 657 + VAAGRAH+ LT VYT G+N Sbjct: 231 VSQVAAGRAHSAFLTKDGCVYTCGSN 256 >SB_14941| Best HMM Match : SH3_1 (HMM E-Value=1.1e-12) Length = 469 Score = 29.9 bits (64), Expect = 2.3 Identities = 18/47 (38%), Positives = 24/47 (51%), Gaps = 3/47 (6%) Frame = +1 Query: 472 QYRFPNWIPFTTRNHPLELLL---SYAPIYIPYKSLECEIKAVAAGR 603 + +F NWIP+ PLELL SY P+ P E E + + A R Sbjct: 407 EIQFENWIPYFCFVLPLELLQHYPSYRPVLTPATKPEEEPQQITAYR 453 >SB_59432| Best HMM Match : MORN (HMM E-Value=9.3e-26) Length = 1362 Score = 29.5 bits (63), Expect = 3.0 Identities = 14/31 (45%), Positives = 18/31 (58%) Frame = +1 Query: 565 SLECEIKAVAAGRAHTIILTDKEGVYTLGNN 657 SL I VA G AHT++LT V+ G+N Sbjct: 33 SLPHGISKVALGTAHTVLLTFNHEVFAFGDN 63 >SB_46796| Best HMM Match : RCC1 (HMM E-Value=3e-14) Length = 350 Score = 28.3 bits (60), Expect = 7.0 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = +1 Query: 580 IKAVAAGRAHTIILTDKEGVYTLGNNAIWSV 672 I + GR HT+ILTD V+ G+N + + Sbjct: 30 IVQASCGRGHTLILTDAGLVFGFGDNKLGQI 60 >SB_17995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 653 Score = 28.3 bits (60), Expect = 7.0 Identities = 14/50 (28%), Positives = 24/50 (48%), Gaps = 1/50 (2%) Frame = +2 Query: 407 GYGFTVASIKTSEQHKVFGT-GINTDSQIGYHSPREIILWNFCLAMHLFI 553 GYG + + V G G+N + + H E++L + CLA +F+ Sbjct: 548 GYGLGIVQSARQFANLVAGLQGVNLEGMLLNHCKEELLLGDNCLARSIFV 597 >SB_37873| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 192 Score = 27.9 bits (59), Expect = 9.2 Identities = 13/39 (33%), Positives = 24/39 (61%) Frame = +3 Query: 210 PIFQYPISKSTDRRVMCGDLLRQVLWVSTSHVARKGKKV 326 PI + P S+S++RRV +V W+S++ R+ ++V Sbjct: 151 PILKSPRSQSSERRVHFSARSPKVFWISSTLNRRRQRRV 189 >SB_10740| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 27.9 bits (59), Expect = 9.2 Identities = 12/33 (36%), Positives = 19/33 (57%) Frame = +1 Query: 532 LSYAPIYIPYKSLECEIKAVAAGRAHTIILTDK 630 L Y P+++P + CE RA++I LTD+ Sbjct: 57 LGYPPMHVPAWQITCETLRSRDERAYSIQLTDR 89 >SB_28088| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 906 Score = 27.9 bits (59), Expect = 9.2 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = -1 Query: 310 LATWEVDTQSTCLSKSPHMTRLS 242 + TW VD S C S SPH L+ Sbjct: 88 IRTWNVDVNSLCCSWSPHAVWLA 110 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,048,178 Number of Sequences: 59808 Number of extensions: 486236 Number of successful extensions: 1145 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 1046 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1145 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 2022185256 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -