BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30723.Seq (648 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090821-2|BAC57918.1| 1168|Anopheles gambiae reverse transcript... 26 0.89 AF063021-3|AAC16247.1| 484|Anopheles gambiae dopa decarboxylase... 25 2.1 AF063021-2|AAC16249.1| 515|Anopheles gambiae dopa decarboxylase... 25 2.1 AY578811-1|AAT07316.1| 565|Anopheles gambiae thickveins protein. 24 4.8 AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein p... 24 4.8 AF002238-1|AAB97731.1| 327|Anopheles gambiae ribosomal protein ... 23 6.3 AM042695-1|CAJ14970.1| 396|Anopheles gambiae 3-hydroxykynurenin... 23 8.3 AJ302657-1|CAC35522.1| 115|Anopheles gambiae gSG6 protein protein. 23 8.3 >AB090821-2|BAC57918.1| 1168|Anopheles gambiae reverse transcriptase protein. Length = 1168 Score = 26.2 bits (55), Expect = 0.89 Identities = 11/31 (35%), Positives = 22/31 (70%) Frame = -1 Query: 405 FPSVNPGISWAPLRTITRAKTERLASTIHPR 313 +P + G + APLR+I + +++A+++HPR Sbjct: 408 WPDLGVG-NMAPLRSIGLTELDQIAASMHPR 437 >AF063021-3|AAC16247.1| 484|Anopheles gambiae dopa decarboxylase isoform 2 protein. Length = 484 Score = 25.0 bits (52), Expect = 2.1 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = -1 Query: 138 QPLLRRXCAFRKRYEACAR 82 Q +RR CAF K++EA R Sbjct: 379 QAHIRRHCAFAKQFEALCR 397 >AF063021-2|AAC16249.1| 515|Anopheles gambiae dopa decarboxylase isoform 1 protein. Length = 515 Score = 25.0 bits (52), Expect = 2.1 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = -1 Query: 138 QPLLRRXCAFRKRYEACAR 82 Q +RR CAF K++EA R Sbjct: 410 QAHIRRHCAFAKQFEALCR 428 >AY578811-1|AAT07316.1| 565|Anopheles gambiae thickveins protein. Length = 565 Score = 23.8 bits (49), Expect = 4.8 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = +1 Query: 352 SCYCXQGCPGN 384 +CYC CPGN Sbjct: 73 TCYCEGHCPGN 83 >AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein protein. Length = 3325 Score = 23.8 bits (49), Expect = 4.8 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = +2 Query: 41 VPGNGMPXVVRSGGRAQA 94 VPG+G+P SGG A Sbjct: 3225 VPGSGLPAAAASGGAPSA 3242 >AF002238-1|AAB97731.1| 327|Anopheles gambiae ribosomal protein L5 protein. Length = 327 Score = 23.4 bits (48), Expect = 6.3 Identities = 7/17 (41%), Positives = 13/17 (76%) Frame = -2 Query: 422 LDGGVHFHQSIQEFPGH 372 +DGG++ S++ FPG+ Sbjct: 167 VDGGLNIPHSVKRFPGY 183 >AM042695-1|CAJ14970.1| 396|Anopheles gambiae 3-hydroxykynurenine transaminase protein. Length = 396 Score = 23.0 bits (47), Expect = 8.3 Identities = 13/36 (36%), Positives = 16/36 (44%) Frame = +2 Query: 362 VRKGAQEIPGLTDGNVPRRLGPKRASKIRKLFNLSK 469 V GAQ++ G G P + PK IR SK Sbjct: 199 VYTGAQKVLGAPPGITPISISPKALDVIRNRRTKSK 234 >AJ302657-1|CAC35522.1| 115|Anopheles gambiae gSG6 protein protein. Length = 115 Score = 23.0 bits (47), Expect = 8.3 Identities = 12/38 (31%), Positives = 16/38 (42%) Frame = +2 Query: 176 CRWXQRQARIPDETXRPDKQPCSSSDAXGHSCYXXXRD 289 C + + +P P +PC SSD G SC D Sbjct: 66 CECKETREPLPYMYACPGTEPCQSSDRLG-SCSKSMHD 102 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 571,650 Number of Sequences: 2352 Number of extensions: 10551 Number of successful extensions: 22 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 22 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 63977715 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -