BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30719.Seq (797 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value L11618-1|AAB04104.1| 301|Anopheles gambiae ADP/ATP carrier prot... 153 6e-39 L11617-1|AAB04105.1| 301|Anopheles gambiae ADP/ATP carrier prot... 153 6e-39 AY227001-1|AAO32818.2| 301|Anopheles gambiae ADP/ATP translocas... 153 6e-39 CR954256-3|CAJ14144.1| 659|Anopheles gambiae cyclin protein. 31 0.054 AJ439060-17|CAD27768.1| 568|Anopheles gambiae putative chitin b... 23 1.5 M93691-2|AAA29365.1| 1222|Anopheles gambiae protein ( Anopheles ... 25 3.6 U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse tra... 24 4.7 AF364131-1|AAL35507.1| 378|Anopheles gambiae putative odorant r... 24 4.7 AB090823-2|BAC57922.1| 1154|Anopheles gambiae reverse transcript... 24 4.7 EF519516-1|ABP73579.1| 250|Anopheles gambiae APL2 protein. 24 6.3 EF519512-1|ABP73575.1| 250|Anopheles gambiae APL2 protein. 24 6.3 EF519508-1|ABP73571.1| 250|Anopheles gambiae APL2 protein. 24 6.3 EF519528-1|ABP73591.1| 250|Anopheles gambiae APL2 protein. 23 8.3 EF519526-1|ABP73589.1| 250|Anopheles gambiae APL2 protein. 23 8.3 EF519525-1|ABP73588.1| 250|Anopheles gambiae APL2 protein. 23 8.3 EF519523-1|ABP73586.1| 250|Anopheles gambiae APL2 protein. 23 8.3 EF519522-1|ABP73585.1| 250|Anopheles gambiae APL2 protein. 23 8.3 EF519521-1|ABP73584.1| 250|Anopheles gambiae APL2 protein. 23 8.3 EF519519-1|ABP73582.1| 250|Anopheles gambiae APL2 protein. 23 8.3 EF519517-1|ABP73580.1| 250|Anopheles gambiae APL2 protein. 23 8.3 EF519515-1|ABP73578.1| 250|Anopheles gambiae APL2 protein. 23 8.3 EF519514-1|ABP73577.1| 250|Anopheles gambiae APL2 protein. 23 8.3 EF519511-1|ABP73574.1| 250|Anopheles gambiae APL2 protein. 23 8.3 EF519510-1|ABP73573.1| 250|Anopheles gambiae APL2 protein. 23 8.3 DQ974173-1|ABJ52813.1| 553|Anopheles gambiae serpin 16 protein. 23 8.3 >L11618-1|AAB04104.1| 301|Anopheles gambiae ADP/ATP carrier protein protein. Length = 301 Score = 153 bits (371), Expect = 6e-39 Identities = 73/87 (83%), Positives = 79/87 (90%) Frame = +2 Query: 257 AAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANV 436 AAVSKTAVAPIERVKLLLQVQ SKQIA D++YKGIVD FVRIPKEQG+ +FWRGN ANV Sbjct: 21 AAVSKTAVAPIERVKLLLQVQAASKQIAVDKQYKGIVDCFVRIPKEQGIGAFWRGNLANV 80 Query: 437 IRYFPTQALNFAFKDKYKQVFLGGLTR 517 IRYFPTQALNFAFKD YKQVFLGG+ + Sbjct: 81 IRYFPTQALNFAFKDVYKQVFLGGVDK 107 Score = 62.1 bits (144), Expect = 2e-11 Identities = 28/43 (65%), Positives = 29/43 (67%) Frame = +1 Query: 508 LDKKTQFWRYFXXXXXXXXXXXXTSLCFVYPLDFARTRLAADV 636 +DK TQFWRYF TSLCFVYPLDFARTRL ADV Sbjct: 105 VDKNTQFWRYFLGNLGSGGAAGATSLCFVYPLDFARTRLGADV 147 Score = 35.5 bits (78), Expect = 0.002 Identities = 22/69 (31%), Positives = 39/69 (56%) Frame = +2 Query: 284 PIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQAL 463 P + V+ + +Q S ++ YK +D +V+I K++G +F++G F+NV+R AL Sbjct: 232 PFDTVRRRMMMQ--SWPCKSEVMYKNTLDCWVKIGKQEGSGAFFKGAFSNVLR-GTGGAL 288 Query: 464 NFAFKDKYK 490 F D+ K Sbjct: 289 VLVFYDEVK 297 Score = 32.7 bits (71), Expect = 0.014 Identities = 14/19 (73%), Positives = 15/19 (78%) Frame = +3 Query: 198 MSNLADPVAFAKDFLAGGI 254 M+ ADP FAKDFLAGGI Sbjct: 1 MTKKADPYGFAKDFLAGGI 19 >L11617-1|AAB04105.1| 301|Anopheles gambiae ADP/ATP carrier protein protein. Length = 301 Score = 153 bits (371), Expect = 6e-39 Identities = 73/87 (83%), Positives = 79/87 (90%) Frame = +2 Query: 257 AAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANV 436 AAVSKTAVAPIERVKLLLQVQ SKQIA D++YKGIVD FVRIPKEQG+ +FWRGN ANV Sbjct: 21 AAVSKTAVAPIERVKLLLQVQAASKQIAVDKQYKGIVDCFVRIPKEQGIGAFWRGNLANV 80 Query: 437 IRYFPTQALNFAFKDKYKQVFLGGLTR 517 IRYFPTQALNFAFKD YKQVFLGG+ + Sbjct: 81 IRYFPTQALNFAFKDVYKQVFLGGVDK 107 Score = 62.1 bits (144), Expect = 2e-11 Identities = 28/43 (65%), Positives = 29/43 (67%) Frame = +1 Query: 508 LDKKTQFWRYFXXXXXXXXXXXXTSLCFVYPLDFARTRLAADV 636 +DK TQFWRYF TSLCFVYPLDFARTRL ADV Sbjct: 105 VDKNTQFWRYFLGNLGSGGAAGATSLCFVYPLDFARTRLGADV 147 Score = 35.5 bits (78), Expect = 0.002 Identities = 22/69 (31%), Positives = 39/69 (56%) Frame = +2 Query: 284 PIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQAL 463 P + V+ + +Q S ++ YK +D +V+I K++G +F++G F+NV+R AL Sbjct: 232 PFDTVRRRMMMQ--SWPCKSEVMYKNTLDCWVKIGKQEGSGAFFKGAFSNVLR-GTGGAL 288 Query: 464 NFAFKDKYK 490 F D+ K Sbjct: 289 VLVFYDEVK 297 Score = 32.7 bits (71), Expect = 0.014 Identities = 14/19 (73%), Positives = 15/19 (78%) Frame = +3 Query: 198 MSNLADPVAFAKDFLAGGI 254 M+ ADP FAKDFLAGGI Sbjct: 1 MTKKADPYGFAKDFLAGGI 19 >AY227001-1|AAO32818.2| 301|Anopheles gambiae ADP/ATP translocase protein. Length = 301 Score = 153 bits (371), Expect = 6e-39 Identities = 73/87 (83%), Positives = 79/87 (90%) Frame = +2 Query: 257 AAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANV 436 AAVSKTAVAPIERVKLLLQVQ SKQIA D++YKGIVD FVRIPKEQG+ +FWRGN ANV Sbjct: 21 AAVSKTAVAPIERVKLLLQVQAASKQIAVDKQYKGIVDCFVRIPKEQGIGAFWRGNLANV 80 Query: 437 IRYFPTQALNFAFKDKYKQVFLGGLTR 517 IRYFPTQALNFAFKD YKQVFLGG+ + Sbjct: 81 IRYFPTQALNFAFKDVYKQVFLGGVDK 107 Score = 62.1 bits (144), Expect = 2e-11 Identities = 28/43 (65%), Positives = 29/43 (67%) Frame = +1 Query: 508 LDKKTQFWRYFXXXXXXXXXXXXTSLCFVYPLDFARTRLAADV 636 +DK TQFWRYF TSLCFVYPLDFARTRL ADV Sbjct: 105 VDKNTQFWRYFLGNLGSGGAAGATSLCFVYPLDFARTRLGADV 147 Score = 36.7 bits (81), Expect = 8e-04 Identities = 22/69 (31%), Positives = 40/69 (57%) Frame = +2 Query: 284 PIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQAL 463 P + V+ + +Q S + ++ YK +D +V+I K++G +F++G F+NV+R AL Sbjct: 232 PFDTVRRRMMMQ--SGRAKSEVMYKNTLDCWVKIGKQEGSGAFFKGAFSNVLR-GTGGAL 288 Query: 464 NFAFKDKYK 490 F D+ K Sbjct: 289 VLVFYDEVK 297 Score = 32.7 bits (71), Expect = 0.014 Identities = 14/19 (73%), Positives = 15/19 (78%) Frame = +3 Query: 198 MSNLADPVAFAKDFLAGGI 254 M+ ADP FAKDFLAGGI Sbjct: 1 MTKKADPYGFAKDFLAGGI 19 >CR954256-3|CAJ14144.1| 659|Anopheles gambiae cyclin protein. Length = 659 Score = 30.7 bits (66), Expect = 0.054 Identities = 26/67 (38%), Positives = 34/67 (50%) Frame = +1 Query: 178 RSHNRTKCRTSPIRSRSLRTSWLAVSRRRLQDRRSTHRACQAAAPSTARQQADRRRPALQ 357 +S +R+K RTS RSRS RT A R + R T + AA + A + RRR + Sbjct: 444 QSRSRSKTRTS--RSRS-RTPLPARGHVRARLTRRTIPPTRVAAAAAAPEGRRRRRAIAR 500 Query: 358 GYRRRLR 378 RRR R Sbjct: 501 ARRRRCR 507 >AJ439060-17|CAD27768.1| 568|Anopheles gambiae putative chitin binding protein protein. Length = 568 Score = 22.6 bits (46), Expect(2) = 1.5 Identities = 8/11 (72%), Positives = 9/11 (81%) Frame = -1 Query: 371 RRRYPCNAGRR 339 RRRYP NAG + Sbjct: 346 RRRYPTNAGHK 356 Score = 21.4 bits (43), Expect(2) = 1.5 Identities = 9/24 (37%), Positives = 11/24 (45%) Frame = -1 Query: 428 RSYHARMKGDPAPWGCARRRRRYP 357 R R++ P P R RRR P Sbjct: 315 REAAGRLRTGPVPGAAERHRRRRP 338 >M93691-2|AAA29365.1| 1222|Anopheles gambiae protein ( Anopheles gambiae RT2 retroposon. ). Length = 1222 Score = 24.6 bits (51), Expect = 3.6 Identities = 18/45 (40%), Positives = 24/45 (53%), Gaps = 1/45 (2%) Frame = +1 Query: 247 AVSRRRLQDRRSTHRACQAAAPSTA-RQQADRRRPALQGYRRRLR 378 A + RR ++RR+ A+P TA R+ A R R A RRR R Sbjct: 1117 AATARRREERRAGLPPTPPASPRTAQRRAALRERQARFRERRRNR 1161 >U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse transcriptase protein. Length = 1049 Score = 24.2 bits (50), Expect = 4.7 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = -2 Query: 742 HRKPLYRPIQTLRTLKILLMHFPRPENSR 656 HR +Y P +TLR+ + L + PR R Sbjct: 983 HRVDIYAPSRTLRSRETLRLAQPRSSAGR 1011 >AF364131-1|AAL35507.1| 378|Anopheles gambiae putative odorant receptor Or2 protein. Length = 378 Score = 24.2 bits (50), Expect = 4.7 Identities = 17/50 (34%), Positives = 25/50 (50%) Frame = +1 Query: 229 LRTSWLAVSRRRLQDRRSTHRACQAAAPSTARQQADRRRPALQGYRRRLR 378 LRTS+L ++RR+ + AA ++ D RP L+ Y RR R Sbjct: 73 LRTSFLVINRRKFETFFE-----GVAAEYALLEKNDDIRPVLERYTRRGR 117 >AB090823-2|BAC57922.1| 1154|Anopheles gambiae reverse transcriptase protein. Length = 1154 Score = 24.2 bits (50), Expect = 4.7 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = -2 Query: 589 STERWLRRHHRRPDYQRSNARTASSCQ 509 + +RWLR HH + ++ SS Q Sbjct: 698 AVDRWLREHHLELAHAKTEMTVISSLQ 724 >EF519516-1|ABP73579.1| 250|Anopheles gambiae APL2 protein. Length = 250 Score = 23.8 bits (49), Expect = 6.3 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = +3 Query: 540 RW*SGLRWCRRSHLSVLRVPPRLR 611 RW L + LSV+R+PP LR Sbjct: 136 RWSFDLIDASHNKLSVVRIPPNLR 159 >EF519512-1|ABP73575.1| 250|Anopheles gambiae APL2 protein. Length = 250 Score = 23.8 bits (49), Expect = 6.3 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = +3 Query: 540 RW*SGLRWCRRSHLSVLRVPPRLR 611 RW L + LSV+R+PP LR Sbjct: 136 RWSFDLIDASHNKLSVVRIPPNLR 159 >EF519508-1|ABP73571.1| 250|Anopheles gambiae APL2 protein. Length = 250 Score = 23.8 bits (49), Expect = 6.3 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = +3 Query: 540 RW*SGLRWCRRSHLSVLRVPPRLR 611 RW L + LSV+R+PP LR Sbjct: 136 RWSFDLIDASHNKLSVVRIPPNLR 159 >EF519528-1|ABP73591.1| 250|Anopheles gambiae APL2 protein. Length = 250 Score = 23.4 bits (48), Expect = 8.3 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = +3 Query: 540 RW*SGLRWCRRSHLSVLRVPPRLR 611 RW L + LSV+R+PP LR Sbjct: 136 RWSFDLIDASXNKLSVVRIPPNLR 159 >EF519526-1|ABP73589.1| 250|Anopheles gambiae APL2 protein. Length = 250 Score = 23.4 bits (48), Expect = 8.3 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = +3 Query: 540 RW*SGLRWCRRSHLSVLRVPPRLR 611 RW L + LSV+R+PP LR Sbjct: 136 RWSFDLIDASXNKLSVVRIPPNLR 159 >EF519525-1|ABP73588.1| 250|Anopheles gambiae APL2 protein. Length = 250 Score = 23.4 bits (48), Expect = 8.3 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = +3 Query: 540 RW*SGLRWCRRSHLSVLRVPPRLR 611 RW L + LSV+R+PP LR Sbjct: 136 RWSFDLIDASXNKLSVVRIPPNLR 159 >EF519523-1|ABP73586.1| 250|Anopheles gambiae APL2 protein. Length = 250 Score = 23.4 bits (48), Expect = 8.3 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = +3 Query: 540 RW*SGLRWCRRSHLSVLRVPPRLR 611 RW L + LSV+R+PP LR Sbjct: 136 RWSFDLIDASXNKLSVVRIPPNLR 159 >EF519522-1|ABP73585.1| 250|Anopheles gambiae APL2 protein. Length = 250 Score = 23.4 bits (48), Expect = 8.3 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = +3 Query: 540 RW*SGLRWCRRSHLSVLRVPPRLR 611 RW L + LSV+R+PP LR Sbjct: 136 RWSFDLIDASXNKLSVVRIPPNLR 159 >EF519521-1|ABP73584.1| 250|Anopheles gambiae APL2 protein. Length = 250 Score = 23.4 bits (48), Expect = 8.3 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = +3 Query: 540 RW*SGLRWCRRSHLSVLRVPPRLR 611 RW L + LSV+R+PP LR Sbjct: 136 RWSFDLIDASXNKLSVVRIPPNLR 159 >EF519519-1|ABP73582.1| 250|Anopheles gambiae APL2 protein. Length = 250 Score = 23.4 bits (48), Expect = 8.3 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = +3 Query: 540 RW*SGLRWCRRSHLSVLRVPPRLR 611 RW L + LSV+R+PP LR Sbjct: 136 RWSFDLIDASXNKLSVVRIPPNLR 159 >EF519517-1|ABP73580.1| 250|Anopheles gambiae APL2 protein. Length = 250 Score = 23.4 bits (48), Expect = 8.3 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = +3 Query: 540 RW*SGLRWCRRSHLSVLRVPPRLR 611 RW L + LSV+R+PP LR Sbjct: 136 RWSFDLIDASXNKLSVVRIPPNLR 159 >EF519515-1|ABP73578.1| 250|Anopheles gambiae APL2 protein. Length = 250 Score = 23.4 bits (48), Expect = 8.3 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = +3 Query: 540 RW*SGLRWCRRSHLSVLRVPPRLR 611 RW L + LSV+R+PP LR Sbjct: 136 RWSFDLIDASXNKLSVVRIPPNLR 159 >EF519514-1|ABP73577.1| 250|Anopheles gambiae APL2 protein. Length = 250 Score = 23.4 bits (48), Expect = 8.3 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = +3 Query: 540 RW*SGLRWCRRSHLSVLRVPPRLR 611 RW L + LSV+R+PP LR Sbjct: 136 RWSFDLIDASXNKLSVVRIPPNLR 159 >EF519511-1|ABP73574.1| 250|Anopheles gambiae APL2 protein. Length = 250 Score = 23.4 bits (48), Expect = 8.3 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = +3 Query: 540 RW*SGLRWCRRSHLSVLRVPPRLR 611 RW L + LSV+R+PP LR Sbjct: 136 RWSFDLIDASXNKLSVVRIPPNLR 159 >EF519510-1|ABP73573.1| 250|Anopheles gambiae APL2 protein. Length = 250 Score = 23.4 bits (48), Expect = 8.3 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = +3 Query: 540 RW*SGLRWCRRSHLSVLRVPPRLR 611 RW L + LSV+R+PP LR Sbjct: 136 RWSFDLIDASXNKLSVVRIPPNLR 159 >DQ974173-1|ABJ52813.1| 553|Anopheles gambiae serpin 16 protein. Length = 553 Score = 23.4 bits (48), Expect = 8.3 Identities = 8/20 (40%), Positives = 14/20 (70%) Frame = +3 Query: 30 EFQKRHTPTLCAPVITKLLQ 89 EFQ+R TP + +++K+ Q Sbjct: 350 EFQRRLTPAMIGELVSKMTQ 369 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 791,548 Number of Sequences: 2352 Number of extensions: 15995 Number of successful extensions: 67 Number of sequences better than 10.0: 25 Number of HSP's better than 10.0 without gapping: 54 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 66 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 83992206 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -