BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30718.Seq (499 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY695257-1|AAW21974.1| 224|Tribolium castaneum intermediate neu... 26 0.22 X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. 24 0.87 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 21 4.7 AY453651-1|AAR89057.1| 199|Tribolium castaneum serrate protein. 21 4.7 DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 21 6.2 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 21 6.2 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 21 6.2 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 21 6.2 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 21 6.2 AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 21 8.1 >AY695257-1|AAW21974.1| 224|Tribolium castaneum intermediate neuroblasts defectiveprotein protein. Length = 224 Score = 25.8 bits (54), Expect = 0.22 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = +3 Query: 348 AGWRSNGFTCICLCTIGSAKWKARLHVHSC 437 AG SNG C CL T SAK + + SC Sbjct: 181 AGKASNGNKCCCLRTCSSAK-RPKFENSSC 209 >X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. Length = 524 Score = 23.8 bits (49), Expect = 0.87 Identities = 10/39 (25%), Positives = 15/39 (38%) Frame = +1 Query: 46 RIRTSKCRFSQSYRHLIGHERQRSGGSNQLLLRATQRTC 162 R+ KC F Y+H + + + GS TC Sbjct: 230 RLTCPKCPFITEYKHHLEYHLRNHAGSKPFQCNKCDYTC 268 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 21.4 bits (43), Expect = 4.7 Identities = 15/47 (31%), Positives = 17/47 (36%) Frame = +3 Query: 75 TELSAPYWARATKEWWK*PTASACHTKNMPIKSKRNLITRWMFTS*T 215 TE P W WW T S T ++R TR TS T Sbjct: 1028 TEHMHPDWTTKPSTWWSSTTTSPWWTTT---TTRRTTTTRPTTTSTT 1071 >AY453651-1|AAR89057.1| 199|Tribolium castaneum serrate protein. Length = 199 Score = 21.4 bits (43), Expect = 4.7 Identities = 8/19 (42%), Positives = 10/19 (52%) Frame = +3 Query: 327 PCYSGHFAGWRSNGFTCIC 383 PC +G + N F CIC Sbjct: 76 PCENGGTCVDKINAFQCIC 94 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 21.0 bits (42), Expect = 6.2 Identities = 7/21 (33%), Positives = 13/21 (61%) Frame = +3 Query: 369 FTCICLCTIGSAKWKARLHVH 431 + C+ +GSA AR++V+ Sbjct: 489 YRCVASSKVGSADHSARINVY 509 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 21.0 bits (42), Expect = 6.2 Identities = 7/17 (41%), Positives = 11/17 (64%) Frame = +2 Query: 353 LEVEWVYVHMFVYHWEC 403 LE +++MFV W+C Sbjct: 291 LEQSRYFIYMFVSVWKC 307 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 21.0 bits (42), Expect = 6.2 Identities = 7/17 (41%), Positives = 11/17 (64%) Frame = +2 Query: 353 LEVEWVYVHMFVYHWEC 403 LE +++MFV W+C Sbjct: 291 LEQSRYFIYMFVSVWKC 307 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 21.0 bits (42), Expect = 6.2 Identities = 7/17 (41%), Positives = 11/17 (64%) Frame = +2 Query: 353 LEVEWVYVHMFVYHWEC 403 LE +++MFV W+C Sbjct: 291 LEQSRYFIYMFVSVWKC 307 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 21.0 bits (42), Expect = 6.2 Identities = 7/17 (41%), Positives = 11/17 (64%) Frame = +2 Query: 353 LEVEWVYVHMFVYHWEC 403 LE +++MFV W+C Sbjct: 291 LEQSRYFIYMFVSVWKC 307 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 20.6 bits (41), Expect = 8.1 Identities = 11/30 (36%), Positives = 12/30 (40%) Frame = +1 Query: 34 SNCGRIRTSKCRFSQSYRHLIGHERQRSGG 123 S GRI KC + H RQ GG Sbjct: 630 SGAGRITCEKCGNKIDTSLFVDHIRQCVGG 659 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 134,207 Number of Sequences: 336 Number of extensions: 3180 Number of successful extensions: 11 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 11735024 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -