BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30718.Seq (499 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 25 0.44 L01589-1|AAA27736.1| 81|Apis mellifera zinc finger protein pro... 23 1.8 AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic ac... 23 2.3 AY569781-1|AAS75781.1| 461|Apis mellifera neuronal nicotinic ac... 22 3.1 EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. 22 4.1 DQ151547-1|ABA39280.1| 405|Apis mellifera tyramine receptor pro... 22 4.1 EF589162-1|ABQ84439.1| 686|Apis mellifera hexamerin 70c protein. 21 5.4 EF127805-1|ABL67942.1| 461|Apis mellifera nicotinic acetylcholi... 21 5.4 EF127804-1|ABL67941.1| 461|Apis mellifera nicotinic acetylcholi... 21 5.4 EF127803-1|ABL67940.1| 461|Apis mellifera nicotinic acetylcholi... 21 5.4 EF127802-1|ABL67939.1| 461|Apis mellifera nicotinic acetylcholi... 21 5.4 EF127801-1|ABL67938.1| 461|Apis mellifera nicotinic acetylcholi... 21 5.4 EF127800-1|ABL67937.1| 461|Apis mellifera nicotinic acetylcholi... 21 5.4 DQ435331-1|ABD92646.1| 135|Apis mellifera OBP14 protein. 21 5.4 DQ026036-1|AAY87895.1| 529|Apis mellifera nicotinic acetylcholi... 21 5.4 DQ026035-1|AAY87894.1| 529|Apis mellifera nicotinic acetylcholi... 21 5.4 AY273778-1|AAP33487.1| 427|Apis mellifera ultraspiracle protein... 21 5.4 AF263459-1|AAF73057.1| 427|Apis mellifera ultraspiracle protein... 21 5.4 AF514804-1|AAM51823.1| 537|Apis mellifera neuronal nicotinic ac... 21 9.4 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 21 9.4 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 21 9.4 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 25.0 bits (52), Expect = 0.44 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = +3 Query: 369 FTCICLCTIGSAKWKARLHVHSCRCHSHM 455 + CI +GSA+ ARL+V+ HM Sbjct: 469 YKCIAASKVGSAEHSARLNVYGLPFIRHM 497 >L01589-1|AAA27736.1| 81|Apis mellifera zinc finger protein protein. Length = 81 Score = 23.0 bits (47), Expect = 1.8 Identities = 7/19 (36%), Positives = 11/19 (57%) Frame = +3 Query: 390 TIGSAKWKARLHVHSCRCH 446 ++G+ K R H C+CH Sbjct: 28 SLGALKMHIRTHTLPCKCH 46 >AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic acetylcholine receptoralpha7-1 protein. Length = 555 Score = 22.6 bits (46), Expect = 2.3 Identities = 25/69 (36%), Positives = 33/69 (47%), Gaps = 2/69 (2%) Frame = +2 Query: 182 LNYAMDVYE-LNRRV-NSSESIVGWWGLAMK*PTTPLLYTSIIPVXAVSLSMLLWTLRWL 355 LN +D Y L R V N SE +V +GL + II V + LL T WL Sbjct: 28 LNDLLDTYNVLERPVGNESEPLVLSFGLTLM---------QIIDVD--EKNQLLITNLWL 76 Query: 356 EVEWVYVHM 382 ++EW V+M Sbjct: 77 KLEWNDVNM 85 >AY569781-1|AAS75781.1| 461|Apis mellifera neuronal nicotinic acetylcholine Apisa7-2 subunit protein. Length = 461 Score = 22.2 bits (45), Expect = 3.1 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = -3 Query: 143 RRSSWLLPPLLCRSCPIRCR 84 RRS + PP +CP+ C+ Sbjct: 333 RRSEPVEPPRRKNNCPLHCK 352 >EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. Length = 686 Score = 21.8 bits (44), Expect = 4.1 Identities = 15/81 (18%), Positives = 31/81 (38%) Frame = +2 Query: 11 KVHPVVLFQIVDAYERRNADSHRVIGTLLGTSDKGVVEVTNCFCVPHKEHADQVEAELNY 190 +++P F E +N R + G ++ V + + + E +L+Y Sbjct: 164 EIYPNYFFDSSVIEEAQNLKMSRGSSVVTGMNNIETYIVNTNYSSKYMREYNDPEYKLDY 223 Query: 191 AMDVYELNRRVNSSESIVGWW 253 M+ ELN ++ +W Sbjct: 224 FMEDVELNAYYYYMREMLPYW 244 >DQ151547-1|ABA39280.1| 405|Apis mellifera tyramine receptor protein. Length = 405 Score = 21.8 bits (44), Expect = 4.1 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = +2 Query: 185 NYAMDVYELNRRVNSSE 235 NY DVY+ N V+S E Sbjct: 7 NYYGDVYQWNHTVSSGE 23 >EF589162-1|ABQ84439.1| 686|Apis mellifera hexamerin 70c protein. Length = 686 Score = 21.4 bits (43), Expect = 5.4 Identities = 15/81 (18%), Positives = 31/81 (38%) Frame = +2 Query: 11 KVHPVVLFQIVDAYERRNADSHRVIGTLLGTSDKGVVEVTNCFCVPHKEHADQVEAELNY 190 +++P F E +N R + G ++ V + + + E +L+Y Sbjct: 164 EIYPNYFFDSSVIEEAQNLKMSRGSSVVTGMNNIETYIVNTNYSSKNMREYNDPEYKLDY 223 Query: 191 AMDVYELNRRVNSSESIVGWW 253 M+ ELN ++ +W Sbjct: 224 FMEDVELNAYYYYMREMLPYW 244 >EF127805-1|ABL67942.1| 461|Apis mellifera nicotinic acetylcholine receptor subunitalpha 6 transcript variant 6 protein. Length = 461 Score = 21.4 bits (43), Expect = 5.4 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = +2 Query: 326 SMLLWTLRWLEVEWV 370 + +L T WL++EWV Sbjct: 30 NQILTTNAWLKLEWV 44 >EF127804-1|ABL67941.1| 461|Apis mellifera nicotinic acetylcholine receptor subunitalpha 6 transcript variant 5 protein. Length = 461 Score = 21.4 bits (43), Expect = 5.4 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = +2 Query: 326 SMLLWTLRWLEVEWV 370 + +L T WL++EWV Sbjct: 30 NQILTTNAWLKLEWV 44 >EF127803-1|ABL67940.1| 461|Apis mellifera nicotinic acetylcholine receptor subunitalpha 6 transcript variant 4 protein. Length = 461 Score = 21.4 bits (43), Expect = 5.4 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = +2 Query: 326 SMLLWTLRWLEVEWV 370 + +L T WL++EWV Sbjct: 30 NQILTTNAWLKLEWV 44 >EF127802-1|ABL67939.1| 461|Apis mellifera nicotinic acetylcholine receptor subunitalpha 6 transcript variant 3 protein. Length = 461 Score = 21.4 bits (43), Expect = 5.4 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = +2 Query: 326 SMLLWTLRWLEVEWV 370 + +L T WL++EWV Sbjct: 30 NQILTTNAWLKLEWV 44 >EF127801-1|ABL67938.1| 461|Apis mellifera nicotinic acetylcholine receptor subunitalpha 6 transcript variant 2 protein. Length = 461 Score = 21.4 bits (43), Expect = 5.4 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = +2 Query: 326 SMLLWTLRWLEVEWV 370 + +L T WL++EWV Sbjct: 30 NQILTTNAWLKLEWV 44 >EF127800-1|ABL67937.1| 461|Apis mellifera nicotinic acetylcholine receptor subunitalpha 6 transcript variant 1 protein. Length = 461 Score = 21.4 bits (43), Expect = 5.4 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = +2 Query: 326 SMLLWTLRWLEVEWV 370 + +L T WL++EWV Sbjct: 30 NQILTTNAWLKLEWV 44 >DQ435331-1|ABD92646.1| 135|Apis mellifera OBP14 protein. Length = 135 Score = 21.4 bits (43), Expect = 5.4 Identities = 9/26 (34%), Positives = 13/26 (50%) Frame = +3 Query: 366 GFTCICLCTIGSAKWKARLHVHSCRC 443 GF C+C+ + + K RLH C Sbjct: 9 GF-CVCVGALTIEELKTRLHTEQSVC 33 >DQ026036-1|AAY87895.1| 529|Apis mellifera nicotinic acetylcholine receptor alpha6subunit protein. Length = 529 Score = 21.4 bits (43), Expect = 5.4 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = +2 Query: 326 SMLLWTLRWLEVEWV 370 + +L T WL++EWV Sbjct: 98 NQILTTNAWLKLEWV 112 >DQ026035-1|AAY87894.1| 529|Apis mellifera nicotinic acetylcholine receptor alpha6subunit protein. Length = 529 Score = 21.4 bits (43), Expect = 5.4 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = +2 Query: 326 SMLLWTLRWLEVEWV 370 + +L T WL++EWV Sbjct: 98 NQILTTNAWLKLEWV 112 >AY273778-1|AAP33487.1| 427|Apis mellifera ultraspiracle protein protein. Length = 427 Score = 21.4 bits (43), Expect = 5.4 Identities = 14/53 (26%), Positives = 21/53 (39%), Gaps = 5/53 (9%) Frame = +1 Query: 7 CEGPSCCFISNCGRIRTSKCRFSQSY-----RHLIGHERQRSGGSNQLLLRAT 150 C C I R R CR+ + R + ERQR+ +Q + +T Sbjct: 146 CREEKSCIIDKRQRNRCQYCRYQKCLAMGMKREAVQEERQRTKERDQSEVEST 198 >AF263459-1|AAF73057.1| 427|Apis mellifera ultraspiracle protein protein. Length = 427 Score = 21.4 bits (43), Expect = 5.4 Identities = 14/53 (26%), Positives = 21/53 (39%), Gaps = 5/53 (9%) Frame = +1 Query: 7 CEGPSCCFISNCGRIRTSKCRFSQSY-----RHLIGHERQRSGGSNQLLLRAT 150 C C I R R CR+ + R + ERQR+ +Q + +T Sbjct: 146 CREEKSCIIDKRQRNRCQYCRYQKCLAMGMKREAVQEERQRTKERDQSEVEST 198 >AF514804-1|AAM51823.1| 537|Apis mellifera neuronal nicotinic acetylcholine receptoralpha-3 protein. Length = 537 Score = 20.6 bits (41), Expect = 9.4 Identities = 5/19 (26%), Positives = 12/19 (63%) Frame = -3 Query: 290 ITEEWLVTSLPVPTNQQYF 234 ++ EW + +P N++Y+ Sbjct: 211 LSVEWDILEVPASRNEEYY 229 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 20.6 bits (41), Expect = 9.4 Identities = 9/25 (36%), Positives = 14/25 (56%) Frame = +2 Query: 281 PLLYTSIIPVXAVSLSMLLWTLRWL 355 PL+ ++ V AV + L W R+L Sbjct: 1616 PLIVATVALVVAVVIVALRWRSRYL 1640 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 20.6 bits (41), Expect = 9.4 Identities = 9/25 (36%), Positives = 14/25 (56%) Frame = +2 Query: 281 PLLYTSIIPVXAVSLSMLLWTLRWL 355 PL+ ++ V AV + L W R+L Sbjct: 1612 PLIVATVALVVAVVIVALRWRSRYL 1636 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 155,664 Number of Sequences: 438 Number of extensions: 3682 Number of successful extensions: 21 Number of sequences better than 10.0: 21 Number of HSP's better than 10.0 without gapping: 21 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 21 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 13618701 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -