BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30717.Seq (698 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_32300| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.39 SB_41240| Best HMM Match : UCH (HMM E-Value=9.2e-25) 31 0.90 SB_1305| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.8e-11) 30 2.1 SB_18589| Best HMM Match : Filament (HMM E-Value=0.024) 29 2.7 SB_42627| Best HMM Match : DUF164 (HMM E-Value=0.33) 29 4.8 SB_27985| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_24121| Best HMM Match : 7tm_1 (HMM E-Value=3.1e-08) 28 8.4 SB_8063| Best HMM Match : Homeobox (HMM E-Value=8.5e-24) 28 8.4 >SB_32300| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 676 Score = 32.3 bits (70), Expect = 0.39 Identities = 15/54 (27%), Positives = 34/54 (62%), Gaps = 1/54 (1%) Frame = -1 Query: 176 AIEDKEKRIKFLEAALLKTQTDLSK-LQSRTATIEKISRDLNIEIHEIPESRNE 18 A++DK K ++ ++ K + DLSK +++++T E SR+ +E++ I + + + Sbjct: 277 AMDDKMKSLRLELESVSKQKNDLSKQFETQSSTFENTSRETQVELNLIRKEKEQ 330 >SB_41240| Best HMM Match : UCH (HMM E-Value=9.2e-25) Length = 1088 Score = 31.1 bits (67), Expect = 0.90 Identities = 15/55 (27%), Positives = 31/55 (56%) Frame = +1 Query: 172 IANLKSLCSAVMKSVVLKGLSYQVIKSLKKYVLIFININFTTLNVFYL*NEYDKL 336 + NL +LC + K+ +K ++ ++ +L+ +++ TLN F+ +EYD L Sbjct: 558 VLNLLALCVFLTKTFCIKKSNFLLLNLTVTDLLVGLSLGAKTLNEFFKPSEYDLL 612 >SB_1305| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.8e-11) Length = 1491 Score = 29.9 bits (64), Expect = 2.1 Identities = 17/60 (28%), Positives = 31/60 (51%) Frame = -1 Query: 197 EQRDFKLAIEDKEKRIKFLEAALLKTQTDLSKLQSRTATIEKISRDLNIEIHEIPESRNE 18 E K I+D E +++L+ L D++K ++R +EK +L E+ ++ RNE Sbjct: 538 ESESMKGKIKDLEDEVRYLKERL----EDMAKEKTRRRELEKKIEELQDELDDVSTRRNE 593 >SB_18589| Best HMM Match : Filament (HMM E-Value=0.024) Length = 324 Score = 29.5 bits (63), Expect = 2.7 Identities = 15/57 (26%), Positives = 28/57 (49%) Frame = -1 Query: 194 QRDFKLAIEDKEKRIKFLEAALLKTQTDLSKLQSRTATIEKISRDLNIEIHEIPESR 24 Q+D + E+ ++K LE+A+ + ++DLS +R E I E+ E + Sbjct: 245 QKDLETLREESSNKVKELESAISQLRSDLSTANTRLKEKEDIISSTRTELGSTREEK 301 >SB_42627| Best HMM Match : DUF164 (HMM E-Value=0.33) Length = 412 Score = 28.7 bits (61), Expect = 4.8 Identities = 17/52 (32%), Positives = 26/52 (50%) Frame = -1 Query: 170 EDKEKRIKFLEAALLKTQTDLSKLQSRTATIEKISRDLNIEIHEIPESRNEN 15 ED + + LE + TD +L +R +E SR N+ IH +PE +N Sbjct: 111 EDVAEITERLETVATRETTD--QLLTRVEGLENRSRRNNVIIHNVPEEAEKN 160 >SB_27985| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 231 Score = 28.3 bits (60), Expect = 6.3 Identities = 18/53 (33%), Positives = 29/53 (54%), Gaps = 4/53 (7%) Frame = -1 Query: 170 EDKEKRIKFLEAALLK-TQT---DLSKLQSRTATIEKISRDLNIEIHEIPESR 24 ED+ +++ + A + TQT D+S +QS +EK S + EIH P S+ Sbjct: 175 EDRTPQVRGRKRARTRITQTNDSDVSDIQSNNTPLEKDSSNAQDEIHHTPPSQ 227 >SB_24121| Best HMM Match : 7tm_1 (HMM E-Value=3.1e-08) Length = 320 Score = 27.9 bits (59), Expect = 8.4 Identities = 13/35 (37%), Positives = 21/35 (60%) Frame = +1 Query: 211 SVVLKGLSYQVIKSLKKYVLIFININFTTLNVFYL 315 SVVL L+ V+ ++Y+L+FI T L + Y+ Sbjct: 162 SVVLSYLATFVMNKDQRYLLVFIQFGLTCLIIIYI 196 >SB_8063| Best HMM Match : Homeobox (HMM E-Value=8.5e-24) Length = 963 Score = 27.9 bits (59), Expect = 8.4 Identities = 15/47 (31%), Positives = 24/47 (51%) Frame = -1 Query: 698 AIHPMIQAYPLPRRISLSNLYGKTIFQISPDFNNSRSILAGCSGSLS 558 A+ +I AY + + + Y QI+P NN+ S+L G +LS Sbjct: 344 ALSLLIAAYDVLSLLIAPSTYDALSLQIAPSANNALSLLKGAYDALS 390 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,435,868 Number of Sequences: 59808 Number of extensions: 284162 Number of successful extensions: 688 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 620 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 687 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1829596184 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -