BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30717.Seq (698 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BT025189-1|ABF17880.1| 479|Drosophila melanogaster FI01305p pro... 36 0.070 BT012321-1|AAS77446.1| 421|Drosophila melanogaster AT27170p pro... 36 0.070 AY069482-1|AAL39627.1| 447|Drosophila melanogaster LD21722p pro... 36 0.070 AF017096-4|AAC39086.1| 483|Drosophila melanogaster protein ( Dr... 36 0.070 AE014297-668|AAF54162.1| 479|Drosophila melanogaster CG2670-PA ... 36 0.070 AE013599-2147|AAF58087.2| 7210|Drosophila melanogaster CG18255-P... 29 8.0 AE013599-2141|AAM70936.1| 9270|Drosophila melanogaster CG18255-P... 29 8.0 >BT025189-1|ABF17880.1| 479|Drosophila melanogaster FI01305p protein. Length = 479 Score = 35.5 bits (78), Expect = 0.070 Identities = 19/43 (44%), Positives = 28/43 (65%) Frame = +1 Query: 538 ELESQFILKLPEHPAKILRELLKSGEI*KIVLPYRLDNDMRRG 666 ELESQFI+++P+ A + E + +G I K L +LD D+R G Sbjct: 54 ELESQFIMRVPKELADTVHEAINAGTI-KDRLTIQLDPDLRYG 95 >BT012321-1|AAS77446.1| 421|Drosophila melanogaster AT27170p protein. Length = 421 Score = 35.5 bits (78), Expect = 0.070 Identities = 19/43 (44%), Positives = 28/43 (65%) Frame = +1 Query: 538 ELESQFILKLPEHPAKILRELLKSGEI*KIVLPYRLDNDMRRG 666 ELESQFI+++P+ A + E + +G I K L +LD D+R G Sbjct: 54 ELESQFIMRVPKELADTVHEAINAGTI-KDRLTIQLDPDLRYG 95 >AY069482-1|AAL39627.1| 447|Drosophila melanogaster LD21722p protein. Length = 447 Score = 35.5 bits (78), Expect = 0.070 Identities = 19/43 (44%), Positives = 28/43 (65%) Frame = +1 Query: 538 ELESQFILKLPEHPAKILRELLKSGEI*KIVLPYRLDNDMRRG 666 ELESQFI+++P+ A + E + +G I K L +LD D+R G Sbjct: 22 ELESQFIMRVPKELADTVHEAINAGTI-KDRLTIQLDPDLRYG 63 >AF017096-4|AAC39086.1| 483|Drosophila melanogaster protein ( Drosophila melanogasterprophosphoribosylamidotransferase (Prat) gene, completecds. ). Length = 483 Score = 35.5 bits (78), Expect = 0.070 Identities = 19/43 (44%), Positives = 28/43 (65%) Frame = +1 Query: 538 ELESQFILKLPEHPAKILRELLKSGEI*KIVLPYRLDNDMRRG 666 ELESQFI+++P+ A + E + +G I K L +LD D+R G Sbjct: 54 ELESQFIMRVPKELADTVHEAINAGTI-KDRLTIQLDPDLRYG 95 >AE014297-668|AAF54162.1| 479|Drosophila melanogaster CG2670-PA protein. Length = 479 Score = 35.5 bits (78), Expect = 0.070 Identities = 19/43 (44%), Positives = 28/43 (65%) Frame = +1 Query: 538 ELESQFILKLPEHPAKILRELLKSGEI*KIVLPYRLDNDMRRG 666 ELESQFI+++P+ A + E + +G I K L +LD D+R G Sbjct: 54 ELESQFIMRVPKELADTVHEAINAGTI-KDRLTIQLDPDLRYG 95 >AE013599-2147|AAF58087.2| 7210|Drosophila melanogaster CG18255-PD, isoform D protein. Length = 7210 Score = 28.7 bits (61), Expect = 8.0 Identities = 22/51 (43%), Positives = 31/51 (60%), Gaps = 3/51 (5%) Frame = -1 Query: 152 IKFLEAALLKTQTDLSK-LQSRTATIEKISRDL-NIEIHEIPES-RNENVL 9 IK LEA L TQTD +K LQ +E++ DL NI+I + ++ + E VL Sbjct: 1877 IKQLEACLEVTQTDANKELQQVGKIMEQLKSDLENIQIALVTDTVQQETVL 1927 >AE013599-2141|AAM70936.1| 9270|Drosophila melanogaster CG18255-PA, isoform A protein. Length = 9270 Score = 28.7 bits (61), Expect = 8.0 Identities = 22/51 (43%), Positives = 31/51 (60%), Gaps = 3/51 (5%) Frame = -1 Query: 152 IKFLEAALLKTQTDLSK-LQSRTATIEKISRDL-NIEIHEIPES-RNENVL 9 IK LEA L TQTD +K LQ +E++ DL NI+I + ++ + E VL Sbjct: 1877 IKQLEACLEVTQTDANKELQQVGKIMEQLKSDLENIQIALVTDTVQQETVL 1927 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 25,131,487 Number of Sequences: 53049 Number of extensions: 419653 Number of successful extensions: 1246 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1191 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1246 length of database: 24,988,368 effective HSP length: 83 effective length of database: 20,585,301 effective search space used: 3067209849 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -