BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30716.Seq (748 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_05_0821 - 27960414-27961253 32 0.56 01_06_1249 - 35714645-35716003,35716700-35716761,35717007-357171... 32 0.56 03_02_0156 - 5981080-5982189,5982227-5982247,5983308-5983337 31 0.97 02_01_0410 + 2996779-2997888 29 5.2 09_06_0319 - 22293869-22293906,22294539-22295808 28 6.9 >03_05_0821 - 27960414-27961253 Length = 279 Score = 31.9 bits (69), Expect = 0.56 Identities = 15/45 (33%), Positives = 24/45 (53%), Gaps = 1/45 (2%) Frame = +1 Query: 304 LHVTMFYGLYLCCTTA-KWPFSWIRVPVLCSSNDWRYSWSSQTVV 435 +HV M YG YLCC+ +WP W R + +S+++ V+ Sbjct: 182 VHVAM-YGYYLCCSLGLRWPPRWKRAVTELQIAQFLFSFAASAVM 225 >01_06_1249 - 35714645-35716003,35716700-35716761,35717007-35717181, 35717276-35717301,35717917-35717983,35719803-35719945, 35720337-35720349 Length = 614 Score = 31.9 bits (69), Expect = 0.56 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = -3 Query: 539 WTLWSRTQWVVFDWPVKERPLVGFEEV 459 WTLW+ +Q VV W +K RP E+ Sbjct: 147 WTLWTHSQLVVVGWLLKRRPPTKLSEL 173 >03_02_0156 - 5981080-5982189,5982227-5982247,5983308-5983337 Length = 386 Score = 31.1 bits (67), Expect = 0.97 Identities = 16/52 (30%), Positives = 27/52 (51%) Frame = +2 Query: 326 AYIFVVRQRSGPSVGFAYLCYVAATIGVTAGAHRLWSHKSYKARLPLQILLM 481 AY + V + S+ F Y+ +V TIG+ L+++ PL++LLM Sbjct: 200 AYTWAVAYLASMSIDFVYIKHVVMTIGLNTWGLVLYNNLEALMLFPLEMLLM 251 >02_01_0410 + 2996779-2997888 Length = 369 Score = 28.7 bits (61), Expect = 5.2 Identities = 15/51 (29%), Positives = 26/51 (50%) Frame = +2 Query: 326 AYIFVVRQRSGPSVGFAYLCYVAATIGVTAGAHRLWSHKSYKARLPLQILL 478 AY + V + S+ F Y+ +V TIG+ L+++ PL++LL Sbjct: 183 AYTWAVAYLASMSIDFVYIKHVVMTIGLNTWGLVLYNNLEAFMLFPLEMLL 233 >09_06_0319 - 22293869-22293906,22294539-22295808 Length = 435 Score = 28.3 bits (60), Expect = 6.9 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = -1 Query: 112 AWSTAPISGPGLXNTSFFHLTLKIMS 35 AW+ PIS GL +TSF H+ K ++ Sbjct: 185 AWTCHPISLHGLVDTSFTHINTKAIT 210 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,420,960 Number of Sequences: 37544 Number of extensions: 424222 Number of successful extensions: 958 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 937 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 957 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1980691104 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -