BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30712.Seq (698 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_06_1249 - 35714645-35716003,35716700-35716761,35717007-357171... 31 1.2 10_05_0050 + 8565612-8566523 29 3.5 08_02_1043 + 23906340-23906412,23906525-23906631,23906727-239068... 29 3.5 >01_06_1249 - 35714645-35716003,35716700-35716761,35717007-35717181, 35717276-35717301,35717917-35717983,35719803-35719945, 35720337-35720349 Length = 614 Score = 30.7 bits (66), Expect = 1.2 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = -2 Query: 538 WTLWSRTQWVLFDWPVKERPLVGFEEV 458 WTLW+ +Q V+ W +K RP E+ Sbjct: 147 WTLWTHSQLVVVGWLLKRRPPTKLSEL 173 >10_05_0050 + 8565612-8566523 Length = 303 Score = 29.1 bits (62), Expect = 3.5 Identities = 16/33 (48%), Positives = 23/33 (69%) Frame = +1 Query: 463 LQILLMVFLSLANQRAPIGFETIESITSTAIRT 561 +++LL+VFL LA A +ESITSTA++T Sbjct: 1 MELLLLVFLLLAAMSA-----AVESITSTAVKT 28 >08_02_1043 + 23906340-23906412,23906525-23906631,23906727-23906846, 23907174-23907353,23907508-23907666,23907751-23907920, 23907971-23908165,23908536-23908888,23909047-23909223, 23910402-23910466 Length = 532 Score = 29.1 bits (62), Expect = 3.5 Identities = 12/40 (30%), Positives = 17/40 (42%) Frame = +3 Query: 306 TRYNVLWPISLLYDSEVAFSWIRVPVLCSSNDWRYSWSSQ 425 T Y + L E +F W V C+S W Y W+ + Sbjct: 467 TEYQLFGKAQLEVYGEASFGWSYWTVRCNSVHWDYEWNKR 506 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,568,198 Number of Sequences: 37544 Number of extensions: 384993 Number of successful extensions: 871 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 850 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 871 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1792053856 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -